BLASTX nr result
ID: Mentha24_contig00049133
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00049133 (480 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31867.1| hypothetical protein MIMGU_mgv1a018740mg, partial... 49 4e-06 >gb|EYU31867.1| hypothetical protein MIMGU_mgv1a018740mg, partial [Mimulus guttatus] Length = 275 Score = 48.9 bits (115), Expect(2) = 4e-06 Identities = 21/36 (58%), Positives = 30/36 (83%) Frame = -3 Query: 409 TGDFILVYQNIEDGRYIVEARNKGEDIAPKNVVMNE 302 T D+ILVYQN+EDG+Y++EAR K E AP+ +++NE Sbjct: 195 TDDYILVYQNVEDGKYVIEARKKEEQDAPR-ILLNE 229 Score = 27.3 bits (59), Expect(2) = 4e-06 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -1 Query: 240 VFAYDYDFFDDSPLDYMG 187 ++ Y+ F DD+PLDY+G Sbjct: 252 LYEYNATFMDDTPLDYLG 269