BLASTX nr result
ID: Mentha24_contig00048996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00048996 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299255.2| hypothetical protein POPTR_0001s05210g, part... 61 6e-13 gb|ACO38855.1| hypothetical protein [Populus balsamifera] 61 6e-13 gb|ACO38796.1| hypothetical protein [Populus balsamifera] gi|226... 61 6e-13 ref|XP_006354209.1| PREDICTED: G-type lectin S-receptor-like ser... 74 3e-11 ref|XP_006354207.1| PREDICTED: G-type lectin S-receptor-like ser... 74 3e-11 ref|XP_004154674.1| PREDICTED: G-type lectin S-receptor-like ser... 74 3e-11 ref|XP_004149038.1| PREDICTED: G-type lectin S-receptor-like ser... 74 3e-11 ref|XP_007014871.1| Receptor protein kinase 1 [Theobroma cacao] ... 72 6e-11 gb|EXB28985.1| G-type lectin S-receptor-like serine/threonine-pr... 70 2e-10 ref|XP_007014867.1| CCHC-type integrase, putative [Theobroma cac... 70 2e-10 ref|XP_004228923.1| PREDICTED: G-type lectin S-receptor-like ser... 70 2e-10 ref|XP_002533013.1| conserved hypothetical protein [Ricinus comm... 66 2e-10 gb|ABV30743.1| kinase-like protein [Prunus serrulata] 70 3e-10 gb|EXB28974.1| G-type lectin S-receptor-like serine/threonine-pr... 69 7e-10 gb|ABV54825.1| kinase-like protein [Prunus serrulata] 69 7e-10 gb|ABV30775.1| kinase-like protein [Prunus cerasus var. caproniana] 69 7e-10 gb|EXC19918.1| G-type lectin S-receptor-like serine/threonine-pr... 69 9e-10 ref|XP_007014873.1| Receptor-like protein kinase 1 [Theobroma ca... 69 9e-10 ref|XP_006494282.1| PREDICTED: G-type lectin S-receptor-like ser... 68 1e-09 ref|XP_006445955.1| hypothetical protein CICLE_v10014329mg [Citr... 68 1e-09 >ref|XP_002299255.2| hypothetical protein POPTR_0001s05210g, partial [Populus trichocarpa] gi|550346558|gb|EEE84060.2| hypothetical protein POPTR_0001s05210g, partial [Populus trichocarpa] Length = 623 Score = 61.2 bits (147), Expect(2) = 6e-13 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 4/58 (6%) Frame = +2 Query: 221 LLGSCNEGPNRLLVYEHMAKGNLATFLFDSDPKPSWRQRTRIAVGIAD----LHEECS 382 ++G C+EG +R+LVYE ++ G LA+FLF D K SW QRT+IA GIA LH+ECS Sbjct: 536 VIGFCDEGQHRMLVYEFLSNGALASFLF-GDVKLSWNQRTQIAFGIARGLLYLHDECS 592 Score = 38.1 bits (87), Expect(2) = 6e-13 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = +3 Query: 171 SNLRCFTYKELVQATNGSSDPATRG 245 SNLRCF+YKEL++ATNG + RG Sbjct: 472 SNLRCFSYKELMEATNGFKEELGRG 496 >gb|ACO38855.1| hypothetical protein [Populus balsamifera] Length = 198 Score = 61.2 bits (147), Expect(2) = 6e-13 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 4/58 (6%) Frame = +2 Query: 221 LLGSCNEGPNRLLVYEHMAKGNLATFLFDSDPKPSWRQRTRIAVGIAD----LHEECS 382 ++G C+EG +R+LVYE ++ G LA+FLF D K SW QRT+IA GIA LH+ECS Sbjct: 123 VIGFCDEGQHRMLVYEFLSNGALASFLF-GDVKLSWNQRTQIAFGIARGLLYLHDECS 179 Score = 38.1 bits (87), Expect(2) = 6e-13 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = +3 Query: 171 SNLRCFTYKELVQATNGSSDPATRG 245 SNLRCF+YKEL++ATNG + RG Sbjct: 59 SNLRCFSYKELMEATNGFKEEQGRG 83 >gb|ACO38796.1| hypothetical protein [Populus balsamifera] gi|226229518|gb|ACO38797.1| hypothetical protein [Populus balsamifera] gi|226229520|gb|ACO38798.1| hypothetical protein [Populus balsamifera] gi|226229522|gb|ACO38799.1| hypothetical protein [Populus balsamifera] gi|226229524|gb|ACO38800.1| hypothetical protein [Populus balsamifera] gi|226229526|gb|ACO38801.1| hypothetical protein [Populus balsamifera] gi|226229528|gb|ACO38802.1| hypothetical protein [Populus balsamifera] gi|226229530|gb|ACO38803.1| hypothetical protein [Populus balsamifera] gi|226229532|gb|ACO38804.1| hypothetical protein [Populus balsamifera] gi|226229534|gb|ACO38805.1| hypothetical protein [Populus balsamifera] gi|226229536|gb|ACO38806.1| hypothetical protein [Populus balsamifera] gi|226229538|gb|ACO38807.1| hypothetical protein [Populus balsamifera] gi|226229540|gb|ACO38808.1| hypothetical protein [Populus balsamifera] gi|226229542|gb|ACO38809.1| hypothetical protein [Populus balsamifera] gi|226229544|gb|ACO38810.1| hypothetical protein [Populus balsamifera] gi|226229546|gb|ACO38811.1| hypothetical protein [Populus balsamifera] gi|226229548|gb|ACO38812.1| hypothetical protein [Populus balsamifera] gi|226229550|gb|ACO38813.1| hypothetical protein [Populus balsamifera] gi|226229552|gb|ACO38814.1| hypothetical protein [Populus balsamifera] gi|226229554|gb|ACO38815.1| hypothetical protein [Populus balsamifera] gi|226229556|gb|ACO38816.1| hypothetical protein [Populus balsamifera] gi|226229558|gb|ACO38817.1| hypothetical protein [Populus balsamifera] gi|226229560|gb|ACO38818.1| hypothetical protein [Populus balsamifera] gi|226229562|gb|ACO38819.1| hypothetical protein [Populus balsamifera] gi|226229564|gb|ACO38820.1| hypothetical protein [Populus balsamifera] gi|226229566|gb|ACO38821.1| hypothetical protein [Populus balsamifera] gi|226229568|gb|ACO38822.1| hypothetical protein [Populus balsamifera] gi|226229570|gb|ACO38823.1| hypothetical protein [Populus balsamifera] gi|226229572|gb|ACO38824.1| hypothetical protein [Populus balsamifera] gi|226229574|gb|ACO38825.1| hypothetical protein [Populus balsamifera] gi|226229576|gb|ACO38826.1| hypothetical protein [Populus balsamifera] gi|226229578|gb|ACO38827.1| hypothetical protein [Populus balsamifera] gi|226229580|gb|ACO38828.1| hypothetical protein [Populus balsamifera] gi|226229582|gb|ACO38829.1| hypothetical protein [Populus balsamifera] gi|226229584|gb|ACO38830.1| hypothetical protein [Populus balsamifera] gi|226229586|gb|ACO38831.1| hypothetical protein [Populus balsamifera] gi|226229588|gb|ACO38832.1| hypothetical protein [Populus balsamifera] gi|226229590|gb|ACO38833.1| hypothetical protein [Populus balsamifera] gi|226229592|gb|ACO38834.1| hypothetical protein [Populus balsamifera] gi|226229594|gb|ACO38835.1| hypothetical protein [Populus balsamifera] gi|226229596|gb|ACO38836.1| hypothetical protein [Populus balsamifera] gi|226229598|gb|ACO38837.1| hypothetical protein [Populus balsamifera] gi|226229600|gb|ACO38838.1| hypothetical protein [Populus balsamifera] gi|226229602|gb|ACO38839.1| hypothetical protein [Populus balsamifera] gi|226229604|gb|ACO38840.1| hypothetical protein [Populus balsamifera] gi|226229606|gb|ACO38841.1| hypothetical protein [Populus balsamifera] gi|226229608|gb|ACO38842.1| hypothetical protein [Populus balsamifera] gi|226229610|gb|ACO38843.1| hypothetical protein [Populus balsamifera] gi|226229612|gb|ACO38844.1| hypothetical protein [Populus balsamifera] gi|226229614|gb|ACO38845.1| hypothetical protein [Populus balsamifera] gi|226229616|gb|ACO38846.1| hypothetical protein [Populus balsamifera] gi|226229618|gb|ACO38847.1| hypothetical protein [Populus balsamifera] gi|226229620|gb|ACO38848.1| hypothetical protein [Populus balsamifera] gi|226229622|gb|ACO38849.1| hypothetical protein [Populus balsamifera] gi|226229624|gb|ACO38850.1| hypothetical protein [Populus balsamifera] gi|226229626|gb|ACO38851.1| hypothetical protein [Populus balsamifera] gi|226229628|gb|ACO38852.1| hypothetical protein [Populus balsamifera] gi|226229630|gb|ACO38853.1| hypothetical protein [Populus balsamifera] gi|226229632|gb|ACO38854.1| hypothetical protein [Populus balsamifera] gi|226229636|gb|ACO38856.1| hypothetical protein [Populus balsamifera] gi|226229638|gb|ACO38857.1| hypothetical protein [Populus balsamifera] gi|226229640|gb|ACO38858.1| hypothetical protein [Populus balsamifera] gi|226229642|gb|ACO38859.1| hypothetical protein [Populus balsamifera] gi|226229644|gb|ACO38860.1| hypothetical protein [Populus balsamifera] gi|226229646|gb|ACO38861.1| hypothetical protein [Populus balsamifera] gi|226229648|gb|ACO38862.1| hypothetical protein [Populus balsamifera] gi|226229650|gb|ACO38863.1| hypothetical protein [Populus balsamifera] gi|226229652|gb|ACO38864.1| hypothetical protein [Populus balsamifera] gi|226229654|gb|ACO38865.1| hypothetical protein [Populus balsamifera] gi|226229656|gb|ACO38866.1| hypothetical protein [Populus balsamifera] gi|226229658|gb|ACO38867.1| hypothetical protein [Populus balsamifera] gi|226229660|gb|ACO38868.1| hypothetical protein [Populus balsamifera] gi|226229662|gb|ACO38869.1| hypothetical protein [Populus balsamifera] gi|226229664|gb|ACO38870.1| hypothetical protein [Populus balsamifera] gi|226229666|gb|ACO38871.1| hypothetical protein [Populus balsamifera] gi|226229668|gb|ACO38872.1| hypothetical protein [Populus balsamifera] gi|226229670|gb|ACO38873.1| hypothetical protein [Populus balsamifera] gi|226229672|gb|ACO38874.1| hypothetical protein [Populus balsamifera] gi|226229674|gb|ACO38875.1| hypothetical protein [Populus balsamifera] gi|226229676|gb|ACO38876.1| hypothetical protein [Populus balsamifera] gi|226229678|gb|ACO38877.1| hypothetical protein [Populus balsamifera] gi|226229680|gb|ACO38878.1| hypothetical protein [Populus balsamifera] gi|226229682|gb|ACO38879.1| hypothetical protein [Populus balsamifera] gi|226229684|gb|ACO38880.1| hypothetical protein [Populus balsamifera] gi|226229686|gb|ACO38881.1| hypothetical protein [Populus balsamifera] Length = 198 Score = 61.2 bits (147), Expect(2) = 6e-13 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 4/58 (6%) Frame = +2 Query: 221 LLGSCNEGPNRLLVYEHMAKGNLATFLFDSDPKPSWRQRTRIAVGIAD----LHEECS 382 ++G C+EG +R+LVYE ++ G LA+FLF D K SW QRT+IA GIA LH+ECS Sbjct: 123 VIGFCDEGQHRMLVYEFLSNGALASFLF-GDVKLSWNQRTQIAFGIARGLLYLHDECS 179 Score = 38.1 bits (87), Expect(2) = 6e-13 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = +3 Query: 171 SNLRCFTYKELVQATNGSSDPATRG 245 SNLRCF+YKEL++ATNG + RG Sbjct: 59 SNLRCFSYKELMEATNGFKEELGRG 83 >ref|XP_006354209.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1-like [Solanum tuberosum] Length = 684 Score = 73.6 bits (179), Expect = 3e-11 Identities = 37/58 (63%), Positives = 45/58 (77%), Gaps = 4/58 (6%) Frame = +2 Query: 221 LLGSCNEGPNRLLVYEHMAKGNLATFLFDSDPKPSWRQRTRIAVGIAD----LHEECS 382 L+G CNEGP+RLLVYE+M+ G LA+F+F D KP+W QRT IA+GIA LHEECS Sbjct: 456 LIGYCNEGPHRLLVYEYMSNGTLASFIF-GDLKPTWSQRTSIAMGIARGLAYLHEECS 512 >ref|XP_006354207.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1-like [Solanum tuberosum] Length = 684 Score = 73.6 bits (179), Expect = 3e-11 Identities = 37/58 (63%), Positives = 45/58 (77%), Gaps = 4/58 (6%) Frame = +2 Query: 221 LLGSCNEGPNRLLVYEHMAKGNLATFLFDSDPKPSWRQRTRIAVGIAD----LHEECS 382 L+G CNEGP+RLLVYE+M+ G LA+F+F D KP+W QRT IA+GIA LHEECS Sbjct: 456 LIGYCNEGPHRLLVYEYMSNGTLASFIF-GDLKPTWSQRTSIAMGIARGLAYLHEECS 512 >ref|XP_004154674.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1-like [Cucumis sativus] Length = 812 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/57 (59%), Positives = 45/57 (78%), Gaps = 4/57 (7%) Frame = +2 Query: 221 LLGSCNEGPNRLLVYEHMAKGNLATFLFDSDPKPSWRQRTRIAV----GIADLHEEC 379 LLG C+EG NR+LVY+ M+ G+L+TFLF++DPKPSW+ RT+IA G+ LHEEC Sbjct: 579 LLGYCDEGNNRMLVYQFMSNGSLSTFLFNNDPKPSWKLRTQIAYEIARGLLYLHEEC 635 >ref|XP_004149038.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1-like [Cucumis sativus] Length = 752 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/57 (59%), Positives = 45/57 (78%), Gaps = 4/57 (7%) Frame = +2 Query: 221 LLGSCNEGPNRLLVYEHMAKGNLATFLFDSDPKPSWRQRTRIAV----GIADLHEEC 379 LLG C+EG NR+LVY+ M+ G+L+TFLF++DPKPSW+ RT+IA G+ LHEEC Sbjct: 519 LLGYCDEGNNRMLVYQFMSNGSLSTFLFNNDPKPSWKLRTQIAYEIARGLLYLHEEC 575 >ref|XP_007014871.1| Receptor protein kinase 1 [Theobroma cacao] gi|508785234|gb|EOY32490.1| Receptor protein kinase 1 [Theobroma cacao] Length = 804 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/58 (63%), Positives = 45/58 (77%), Gaps = 4/58 (6%) Frame = +2 Query: 221 LLGSCNEGPNRLLVYEHMAKGNLATFLFDSDPKPSWRQRTRIAVGIAD----LHEECS 382 LLG C+EG NR+LVYE+++ G LA+FLF D KPSW QRT+IA+GIA LHEECS Sbjct: 577 LLGYCHEGQNRMLVYEYLSNGTLASFLF-GDLKPSWNQRTQIALGIARGLFYLHEECS 633 >gb|EXB28985.1| G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 [Morus notabilis] Length = 821 Score = 70.5 bits (171), Expect = 2e-10 Identities = 36/58 (62%), Positives = 45/58 (77%), Gaps = 4/58 (6%) Frame = +2 Query: 221 LLGSCNEGPNRLLVYEHMAKGNLATFLFDSDPKPSWRQRTRIAVGIAD----LHEECS 382 LLG C++G NRLLVYE+++ G LA+F+F +D KPSWR RT IA+GIA LHEECS Sbjct: 592 LLGYCDDGKNRLLVYEYLSNGTLASFVF-TDIKPSWRGRTEIALGIAKGLLYLHEECS 648 >ref|XP_007014867.1| CCHC-type integrase, putative [Theobroma cacao] gi|508785230|gb|EOY32486.1| CCHC-type integrase, putative [Theobroma cacao] Length = 803 Score = 70.5 bits (171), Expect = 2e-10 Identities = 36/58 (62%), Positives = 44/58 (75%), Gaps = 4/58 (6%) Frame = +2 Query: 221 LLGSCNEGPNRLLVYEHMAKGNLATFLFDSDPKPSWRQRTRIAVGIAD----LHEECS 382 LLG C++G NRLLVYE+++ G LA+FLF D +PSW QRT+IA GIA LHEECS Sbjct: 573 LLGFCDDGDNRLLVYEYLSNGTLASFLF-GDSRPSWSQRTQIAFGIARGLLYLHEECS 629 >ref|XP_004228923.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1-like [Solanum lycopersicum] Length = 827 Score = 70.5 bits (171), Expect = 2e-10 Identities = 36/58 (62%), Positives = 44/58 (75%), Gaps = 4/58 (6%) Frame = +2 Query: 221 LLGSCNEGPNRLLVYEHMAKGNLATFLFDSDPKPSWRQRTRIAVGIAD----LHEECS 382 L+G CNEG +RLLVYE+M+ G LA+F+F D KP+W QRT IA+GIA LHEECS Sbjct: 599 LIGYCNEGAHRLLVYEYMSNGTLASFIF-GDLKPTWSQRTSIAMGIARGLAYLHEECS 655 >ref|XP_002533013.1| conserved hypothetical protein [Ricinus communis] gi|223527202|gb|EEF29367.1| conserved hypothetical protein [Ricinus communis] Length = 1031 Score = 65.9 bits (159), Expect(2) = 2e-10 Identities = 31/58 (53%), Positives = 41/58 (70%), Gaps = 4/58 (6%) Frame = +2 Query: 221 LLGSCNEGPNRLLVYEHMAKGNLATFLFDSDPKPSWRQRTRIAV----GIADLHEECS 382 L G C +G N+LLVYE+M+ G+LA FLF + KP+W +R +IA+ GI LHEECS Sbjct: 536 LFGYCQDGTNKLLVYEYMSSGSLADFLFKGEEKPAWEERIQIALNVARGIFYLHEECS 593 Score = 24.6 bits (52), Expect(2) = 2e-10 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 6/38 (15%) Frame = +3 Query: 150 KLPAHNNSNL------RCFTYKELVQATNGSSDPATRG 245 K+ +H N L R FT+ EL +ATN + RG Sbjct: 474 KISSHPNDELLEDVTLRSFTFDELKKATNNFKNEIGRG 511 >gb|ABV30743.1| kinase-like protein [Prunus serrulata] Length = 164 Score = 70.1 bits (170), Expect = 3e-10 Identities = 36/58 (62%), Positives = 44/58 (75%), Gaps = 4/58 (6%) Frame = +2 Query: 221 LLGSCNEGPNRLLVYEHMAKGNLATFLFDSDPKPSWRQRTRIAVGIAD----LHEECS 382 L+G C+EG +RLLVYE ++KG LA+FLF +D KPSWRQR IA G+A LHEECS Sbjct: 44 LVGYCDEGQHRLLVYEFLSKGTLASFLF-ADTKPSWRQRIEIAYGVARGLLYLHEECS 100 >gb|EXB28974.1| G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 [Morus notabilis] Length = 681 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/58 (56%), Positives = 43/58 (74%), Gaps = 4/58 (6%) Frame = +2 Query: 221 LLGSCNEGPNRLLVYEHMAKGNLATFLFDSDPKPSWRQRTRIAVGIAD----LHEECS 382 LLG CNEG ++LLVYE M+ G+LA FLF S+ KP+W +R RI++G A LHEEC+ Sbjct: 456 LLGFCNEGQHKLLVYEFMSNGSLARFLFGSNSKPNWEKRMRISMGTAKALLYLHEECN 513 >gb|ABV54825.1| kinase-like protein [Prunus serrulata] Length = 148 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/57 (57%), Positives = 41/57 (71%), Gaps = 4/57 (7%) Frame = +2 Query: 221 LLGSCNEGPNRLLVYEHMAKGNLATFLFDSDPKPSWRQRT----RIAVGIADLHEEC 379 LLG C++G NRLLVYE+M G+LA FLF SD +P+W +RT +A GI LHEEC Sbjct: 44 LLGYCHDGSNRLLVYEYMTNGSLADFLFRSDGRPAWEERTGIVLNVAQGILYLHEEC 100 >gb|ABV30775.1| kinase-like protein [Prunus cerasus var. caproniana] Length = 132 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/57 (57%), Positives = 41/57 (71%), Gaps = 4/57 (7%) Frame = +2 Query: 221 LLGSCNEGPNRLLVYEHMAKGNLATFLFDSDPKPSWRQRT----RIAVGIADLHEEC 379 LLG C++G NRLLVYE+M G+LA FLF SD +P+W +RT +A GI LHEEC Sbjct: 28 LLGYCHDGSNRLLVYEYMTNGSLADFLFRSDGRPAWEERTGIVLNVAQGILYLHEEC 84 >gb|EXC19918.1| G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 [Morus notabilis] Length = 788 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/57 (59%), Positives = 41/57 (71%), Gaps = 4/57 (7%) Frame = +2 Query: 221 LLGSCNEGPNRLLVYEHMAKGNLATFLFDSDPKPSWRQRTRIAVGIAD----LHEEC 379 LLG C+EG NRLLVY++M+ G+LA FLF S KP+W QR IA GIA LHE+C Sbjct: 560 LLGYCHEGTNRLLVYDYMSNGSLADFLFKSQVKPNWDQRVGIAFGIAKGILYLHEDC 616 >ref|XP_007014873.1| Receptor-like protein kinase 1 [Theobroma cacao] gi|508785236|gb|EOY32492.1| Receptor-like protein kinase 1 [Theobroma cacao] Length = 1174 Score = 68.6 bits (166), Expect = 9e-10 Identities = 36/58 (62%), Positives = 44/58 (75%), Gaps = 4/58 (6%) Frame = +2 Query: 221 LLGSCNEGPNRLLVYEHMAKGNLATFLFDSDPKPSWRQRTRIAVGIA----DLHEECS 382 LLG CNEG NRLLVYE+M+ G+LA FLF ++ +P+W QR +IA GIA LHEECS Sbjct: 469 LLGFCNEGQNRLLVYEYMSNGSLAKFLF-ANARPNWYQRIQIAFGIAIRLFYLHEECS 525 >ref|XP_006494282.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1-like [Citrus sinensis] Length = 803 Score = 68.2 bits (165), Expect = 1e-09 Identities = 35/57 (61%), Positives = 42/57 (73%), Gaps = 4/57 (7%) Frame = +2 Query: 221 LLGSCNEGPNRLLVYEHMAKGNLATFLFDSDPKPSWRQRTRIAVGIAD----LHEEC 379 LLG C+EG NRLLVYE M+ G +A+FLF D KP+W+ RT IA+GIA LHEEC Sbjct: 575 LLGYCDEGQNRLLVYEFMSNGTVASFLF-GDSKPNWKLRTEIAMGIAGGLFYLHEEC 630 >ref|XP_006445955.1| hypothetical protein CICLE_v10014329mg [Citrus clementina] gi|557548566|gb|ESR59195.1| hypothetical protein CICLE_v10014329mg [Citrus clementina] Length = 792 Score = 68.2 bits (165), Expect = 1e-09 Identities = 36/57 (63%), Positives = 42/57 (73%), Gaps = 4/57 (7%) Frame = +2 Query: 221 LLGSCNEGPNRLLVYEHMAKGNLATFLFDSDPKPSWRQRTRIAVGIAD----LHEEC 379 LLG C+EG NRLLVYE M+ G LA+FLF D KP+W+ RT IA+GIA LHEEC Sbjct: 564 LLGYCDEGQNRLLVYEFMSNGALASFLF-GDSKPNWKLRTEIAMGIARGLFYLHEEC 619