BLASTX nr result
ID: Mentha24_contig00048314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00048314 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37801.1| hypothetical protein MIMGU_mgv1a001045mg [Mimulus... 66 6e-09 >gb|EYU37801.1| hypothetical protein MIMGU_mgv1a001045mg [Mimulus guttatus] Length = 905 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +1 Query: 232 MVDQWSRVVLIFVASFFFLFVHTSEQQLLVSRQERLSLIQLRSSLGLRAR 381 MVD+WSRVV + + F LF T +QQLLVSRQERL L+QLRSSLGLRA+ Sbjct: 1 MVDRWSRVVCVCLCVLFLLFGCTIQQQLLVSRQERLVLLQLRSSLGLRAK 50