BLASTX nr result
ID: Mentha24_contig00048290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00048290 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44167.1| hypothetical protein MIMGU_mgv1a002860mg [Mimulus... 64 2e-08 >gb|EYU44167.1| hypothetical protein MIMGU_mgv1a002860mg [Mimulus guttatus] Length = 630 Score = 64.3 bits (155), Expect = 2e-08 Identities = 39/94 (41%), Positives = 55/94 (58%), Gaps = 1/94 (1%) Frame = -2 Query: 280 EDNSDSEESAVVMDKVTSKKSDSFGTGKEAPVKEN-QKKTIHKNRVVAPEDNKHVSPLKV 104 E+N + E S D + S ++S GK PVKEN QKK++ K R V + K+ SP+K+ Sbjct: 453 EENGEIEYSG---DGLISDSNESLEIGKLPPVKENLQKKSLKKTRGVVVSEEKYSSPVKL 509 Query: 103 KFRMGKVMELQTDNNLPXXXXXXXXXXLGVEEIK 2 KFR GKV++LQ+DN+ P +G EE K Sbjct: 510 KFRSGKVVDLQSDNSGPRKLRFRRARIVGAEEGK 543