BLASTX nr result
ID: Mentha24_contig00048165
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00048165 (405 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCO27414.1| hypothetical protein BN14_01453 [Rhizoctonia sol... 57 3e-06 >emb|CCO27414.1| hypothetical protein BN14_01453 [Rhizoctonia solani AG-1 IB] Length = 250 Score = 56.6 bits (135), Expect = 3e-06 Identities = 33/91 (36%), Positives = 48/91 (52%), Gaps = 3/91 (3%) Frame = -2 Query: 380 FSTVAIVSALAITAQASQQDNERRQLDSILSGATSAFGDATSAVGNG---ATSIFGDATS 210 F+ + ++S LA+ Q + + SI+S TS F TSA G+G ATS+ G S Sbjct: 6 FALITLLSMLAVVLANPAQKRQFPDISSIVSEVTSGFNSLTSAAGSGVGGATSVIGSVAS 65 Query: 209 AVVGGGGSLFTAATSAVGNGGASIVSAATSA 117 V GS+ T ATSA+G+ ++ TSA Sbjct: 66 EVTSAVGSVATEATSAIGSVATEALTFVTSA 96