BLASTX nr result
ID: Mentha24_contig00047964
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00047964 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40075.1| hypothetical protein MIMGU_mgv1a002655mg [Mimulus... 75 1e-11 ref|XP_006355468.1| PREDICTED: BTB/POZ domain-containing protein... 60 3e-07 ref|XP_004245578.1| PREDICTED: BTB/POZ domain-containing protein... 60 4e-07 ref|XP_006343947.1| PREDICTED: BTB/POZ domain-containing protein... 59 5e-07 ref|XP_007210316.1| hypothetical protein PRUPE_ppa002210mg [Prun... 57 3e-06 >gb|EYU40075.1| hypothetical protein MIMGU_mgv1a002655mg [Mimulus guttatus] Length = 649 Score = 74.7 bits (182), Expect = 1e-11 Identities = 41/73 (56%), Positives = 47/73 (64%), Gaps = 12/73 (16%) Frame = -3 Query: 229 MAAATTAHLKSHPQPIKIKRRRCRETTITSTP------------AVPDPTSSSQHQSRSV 86 MAAATT HLK H QPIKIKRRR RETTITSTP A + T S+ + SR + Sbjct: 1 MAAATTTHLKFHNQPIKIKRRRRRETTITSTPTPVDSPLSSSSSAATNTTRSNHYHSRKI 60 Query: 85 DAHITISPDSSWC 47 D IT+SPD+S C Sbjct: 61 DTPITLSPDNSGC 73 >ref|XP_006355468.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Solanum tuberosum] Length = 644 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/65 (49%), Positives = 44/65 (67%), Gaps = 5/65 (7%) Frame = -3 Query: 226 AAATTAHLKSHPQPIKIKRRRCRETTITST--PAVPDPTSSSQ---HQSRSVDAHITISP 62 + +T+ +LK QPIK KRRRCRETTIT++ P+ PT+ S +Q+R VD +SP Sbjct: 10 STSTSTNLKFQIQPIKPKRRRCRETTITTSTNPSHYSPTNCSTQCLNQTRKVDTPTIVSP 69 Query: 61 DSSWC 47 D+SWC Sbjct: 70 DNSWC 74 >ref|XP_004245578.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Solanum lycopersicum] Length = 638 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/62 (51%), Positives = 42/62 (67%), Gaps = 5/62 (8%) Frame = -3 Query: 217 TTAHLKSHPQPIKIKRRRCRETTITST--PAVPDPTSSSQ---HQSRSVDAHITISPDSS 53 T+ +LK QPIK KRRRCRETTIT++ P+ PT+ S +Q+R VD +SPD+S Sbjct: 10 TSTNLKFQIQPIKPKRRRCRETTITASTNPSQYSPTNCSTQCLNQTRKVDTPTIVSPDNS 69 Query: 52 WC 47 WC Sbjct: 70 WC 71 >ref|XP_006343947.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform X1 [Solanum tuberosum] Length = 642 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/63 (50%), Positives = 42/63 (66%), Gaps = 5/63 (7%) Frame = -3 Query: 220 ATTAHLKSHPQPIKIKRRRCRETTI--TSTPAVPDPTSSSQ---HQSRSVDAHITISPDS 56 +T+ +LK QPIK KRRRCRETTI TS P+ PT+ S +++R VD +SPD+ Sbjct: 10 STSTNLKFQIQPIKPKRRRCRETTISTTSNPSHYSPTNCSTQCLNETRKVDTPTIVSPDN 69 Query: 55 SWC 47 SWC Sbjct: 70 SWC 72 >ref|XP_007210316.1| hypothetical protein PRUPE_ppa002210mg [Prunus persica] gi|462406051|gb|EMJ11515.1| hypothetical protein PRUPE_ppa002210mg [Prunus persica] Length = 700 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/58 (46%), Positives = 37/58 (63%) Frame = -3 Query: 220 ATTAHLKSHPQPIKIKRRRCRETTITSTPAVPDPTSSSQHQSRSVDAHITISPDSSWC 47 +TT HLKS P K KRRRCR+T ++S+PA P + +R +D +SP+SSWC Sbjct: 67 STTTHLKSQTNPTKPKRRRCRQTHLSSSPAPP------PNPTRKLDPPTIVSPESSWC 118