BLASTX nr result
ID: Mentha24_contig00047917
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00047917 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532559.1| calcium-dependent protein kinase, putative [... 73 4e-11 gb|AAC25423.1| calcium-dependent protein kinase [Nicotiana tabacum] 70 4e-10 ref|XP_002305576.2| hypothetical protein POPTR_0004s01530g [Popu... 69 9e-10 ref|XP_006406385.1| hypothetical protein EUTSA_v10020475mg [Eutr... 67 2e-09 ref|XP_006389625.1| hypothetical protein POPTR_0021s00750g [Popu... 67 3e-09 gb|ACY78680.1| calcium-dependent protein kinase 1 [Panax ginseng] 66 4e-09 gb|EXB50311.1| Calcium-dependent protein kinase 9 [Morus notabilis] 66 6e-09 ref|XP_006600312.1| PREDICTED: calcium-dependent protein kinase ... 66 6e-09 ref|XP_006303970.1| hypothetical protein CARUB_v10008860mg [Caps... 66 6e-09 ref|XP_003529633.1| PREDICTED: calcium-dependent protein kinase ... 66 6e-09 ref|XP_002891589.1| calcium-dependent protein kinase 33 [Arabido... 66 6e-09 ref|XP_004294385.1| PREDICTED: calcium-dependent protein kinase ... 65 7e-09 ref|NP_175485.1| calcium-dependent protein kinase 33 [Arabidopsi... 65 1e-08 ref|XP_006467440.1| PREDICTED: calcium-dependent protein kinase ... 65 1e-08 ref|XP_006449723.1| hypothetical protein CICLE_v10014823mg [Citr... 65 1e-08 dbj|BAE71239.1| putative calcium dependent protein kinase [Trifo... 65 1e-08 gb|EYU27336.1| hypothetical protein MIMGU_mgv1a004414mg [Mimulus... 64 2e-08 gb|EPS59225.1| calcium-dependent protein kinase 1, partial [Genl... 64 2e-08 ref|XP_006297378.1| hypothetical protein CARUB_v10013403mg [Caps... 64 2e-08 ref|NP_001059775.1| Os07g0515100 [Oryza sativa Japonica Group] g... 64 2e-08 >ref|XP_002532559.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223527714|gb|EEF29820.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 533 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +2 Query: 2 GDLSAIKEIIAEVDSDNDGRINYEEFCTMMRTGNQHQPKL 121 GD + IKEII+EVD+DNDGRINYEEFCTMM+TGNQHQ KL Sbjct: 493 GDDATIKEIISEVDADNDGRINYEEFCTMMKTGNQHQGKL 532 >gb|AAC25423.1| calcium-dependent protein kinase [Nicotiana tabacum] Length = 540 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +2 Query: 2 GDLSAIKEIIAEVDSDNDGRINYEEFCTMMRTGNQHQPKL 121 GD + IKEIIAEVD+DNDGRINYEEFC MMR+G Q QPKL Sbjct: 500 GDEATIKEIIAEVDTDNDGRINYEEFCAMMRSGTQPQPKL 539 >ref|XP_002305576.2| hypothetical protein POPTR_0004s01530g [Populus trichocarpa] gi|550340093|gb|EEE86087.2| hypothetical protein POPTR_0004s01530g [Populus trichocarpa] Length = 532 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +2 Query: 2 GDLSAIKEIIAEVDSDNDGRINYEEFCTMMRTGNQHQPKL 121 GD S+IKEIIAEVD+DNDGRINYEEFC MMR+G H P L Sbjct: 492 GDESSIKEIIAEVDADNDGRINYEEFCAMMRSGTPHAPSL 531 >ref|XP_006406385.1| hypothetical protein EUTSA_v10020475mg [Eutrema salsugineum] gi|557107531|gb|ESQ47838.1| hypothetical protein EUTSA_v10020475mg [Eutrema salsugineum] Length = 537 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = +2 Query: 2 GDLSAIKEIIAEVDSDNDGRINYEEFCTMMRTGNQHQPKL 121 GD IKE++++VDSDNDGRINYEEFC MMR+GN QPKL Sbjct: 497 GDDETIKEVLSDVDSDNDGRINYEEFCAMMRSGNPQQPKL 536 >ref|XP_006389625.1| hypothetical protein POPTR_0021s00750g [Populus trichocarpa] gi|550312454|gb|ERP48539.1| hypothetical protein POPTR_0021s00750g [Populus trichocarpa] Length = 532 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +2 Query: 2 GDLSAIKEIIAEVDSDNDGRINYEEFCTMMRTGNQHQPKL 121 GD + IKEIIAEVD+DNDG+INYEEFC MMR+G QH KL Sbjct: 492 GDEATIKEIIAEVDADNDGKINYEEFCAMMRSGTQHAGKL 531 >gb|ACY78680.1| calcium-dependent protein kinase 1 [Panax ginseng] Length = 549 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/41 (78%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = +2 Query: 2 GDLSAIKEIIAEVDSDNDGRINYEEFCTMMRTG-NQHQPKL 121 GD + IKEII+EVD+DNDGRINYEEFCTMMR+G QHQ KL Sbjct: 508 GDEATIKEIISEVDTDNDGRINYEEFCTMMRSGTTQHQGKL 548 >gb|EXB50311.1| Calcium-dependent protein kinase 9 [Morus notabilis] Length = 548 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = +2 Query: 2 GDLSAIKEIIAEVDSDNDGRINYEEFCTMMRTGNQHQPKL 121 GD + I+EII+EVD+DNDGRINY EFC MMR+G QHQ KL Sbjct: 508 GDEATIREIISEVDTDNDGRINYSEFCAMMRSGTQHQGKL 547 >ref|XP_006600312.1| PREDICTED: calcium-dependent protein kinase isoform 2-like [Glycine max] Length = 538 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +2 Query: 2 GDLSAIKEIIAEVDSDNDGRINYEEFCTMMRTGNQHQPKLL 124 GD + IKEII+EVD+DNDGRINYEEFC MMR+G HQ +LL Sbjct: 498 GDEATIKEIISEVDADNDGRINYEEFCAMMRSGMPHQGQLL 538 >ref|XP_006303970.1| hypothetical protein CARUB_v10008860mg [Capsella rubella] gi|482572681|gb|EOA36868.1| hypothetical protein CARUB_v10008860mg [Capsella rubella] Length = 520 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = +2 Query: 2 GDLSAIKEIIAEVDSDNDGRINYEEFCTMMRTGNQHQPKL 121 GD + IKEI+++VDSDNDG+INYEEFC MMR+GN QP+L Sbjct: 480 GDDATIKEILSDVDSDNDGKINYEEFCAMMRSGNPQQPRL 519 >ref|XP_003529633.1| PREDICTED: calcium-dependent protein kinase isoform [Glycine max] Length = 529 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +2 Query: 2 GDLSAIKEIIAEVDSDNDGRINYEEFCTMMRTGNQHQPKLL 124 GD + IKEII+EVD+DNDGRINYEEFC MMR+G HQ +LL Sbjct: 489 GDEATIKEIISEVDTDNDGRINYEEFCAMMRSGMPHQGQLL 529 >ref|XP_002891589.1| calcium-dependent protein kinase 33 [Arabidopsis lyrata subsp. lyrata] gi|297337431|gb|EFH67848.1| calcium-dependent protein kinase 33 [Arabidopsis lyrata subsp. lyrata] Length = 521 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = +2 Query: 2 GDLSAIKEIIAEVDSDNDGRINYEEFCTMMRTGNQHQPKL 121 GD + IKEI+++VD+DNDGRINYEEFC MMR+GN QP+L Sbjct: 481 GDDATIKEILSDVDADNDGRINYEEFCAMMRSGNPQQPRL 520 >ref|XP_004294385.1| PREDICTED: calcium-dependent protein kinase 9-like [Fragaria vesca subsp. vesca] Length = 541 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +2 Query: 2 GDLSAIKEIIAEVDSDNDGRINYEEFCTMMRTGNQHQPKL 121 GD + I++II+EVD+DNDGRINYEEFCTMMR+G Q Q KL Sbjct: 501 GDEATIRDIISEVDTDNDGRINYEEFCTMMRSGTQQQGKL 540 >ref|NP_175485.1| calcium-dependent protein kinase 33 [Arabidopsis thaliana] gi|75333437|sp|Q9C6P3.1|CDPKX_ARATH RecName: Full=Calcium-dependent protein kinase 33 gi|12322336|gb|AAG51192.1|AC079279_13 calcium-dependent protein kinase [Arabidopsis thaliana] gi|46931348|gb|AAT06478.1| At1g50700 [Arabidopsis thaliana] gi|51969388|dbj|BAD43386.1| hypothetical protein [Arabidopsis thaliana] gi|332194460|gb|AEE32581.1| calcium-dependent protein kinase 33 [Arabidopsis thaliana] Length = 521 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = +2 Query: 2 GDLSAIKEIIAEVDSDNDGRINYEEFCTMMRTGNQHQPKL 121 GD + IKEI+++VD+DNDGRINY+EFC MMR+GN QP+L Sbjct: 481 GDDATIKEILSDVDADNDGRINYDEFCAMMRSGNPQQPRL 520 >ref|XP_006467440.1| PREDICTED: calcium-dependent protein kinase 21-like [Citrus sinensis] Length = 544 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +2 Query: 2 GDLSAIKEIIAEVDSDNDGRINYEEFCTMMRTGNQHQPKLL 124 GD ++IKEII+EVD+DNDGRINYEEFCTMMR+G KL+ Sbjct: 504 GDEASIKEIISEVDTDNDGRINYEEFCTMMRSGTPQPAKLI 544 >ref|XP_006449723.1| hypothetical protein CICLE_v10014823mg [Citrus clementina] gi|557552334|gb|ESR62963.1| hypothetical protein CICLE_v10014823mg [Citrus clementina] Length = 544 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +2 Query: 2 GDLSAIKEIIAEVDSDNDGRINYEEFCTMMRTGNQHQPKLL 124 GD ++IKEII+EVD+DNDGRINYEEFCTMMR+G KL+ Sbjct: 504 GDEASIKEIISEVDTDNDGRINYEEFCTMMRSGTPQPAKLI 544 >dbj|BAE71239.1| putative calcium dependent protein kinase [Trifolium pratense] Length = 558 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = +2 Query: 2 GDLSAIKEIIAEVDSDNDGRINYEEFCTMMRTGNQHQPKL 121 GD + IKEII+EVD+DNDGRINYEEFC MMR+G HQ +L Sbjct: 518 GDEATIKEIISEVDTDNDGRINYEEFCAMMRSGMPHQAQL 557 >gb|EYU27336.1| hypothetical protein MIMGU_mgv1a004414mg [Mimulus guttatus] Length = 528 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 2 GDLSAIKEIIAEVDSDNDGRINYEEFCTMMRTGNQHQ 112 GD S IK+IIAEVD+DNDGRINYEEFC MMRTG+ Q Sbjct: 485 GDQSTIKDIIAEVDTDNDGRINYEEFCNMMRTGSTQQ 521 >gb|EPS59225.1| calcium-dependent protein kinase 1, partial [Genlisea aurea] Length = 503 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 2 GDLSAIKEIIAEVDSDNDGRINYEEFCTMMRTGNQHQP 115 GD + I+EII+EVD+DNDGRINYEEFCTMMR+G QP Sbjct: 462 GDEATIREIISEVDTDNDGRINYEEFCTMMRSGTTQQP 499 >ref|XP_006297378.1| hypothetical protein CARUB_v10013403mg [Capsella rubella] gi|482566087|gb|EOA30276.1| hypothetical protein CARUB_v10013403mg [Capsella rubella] Length = 540 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/42 (69%), Positives = 36/42 (85%), Gaps = 2/42 (4%) Frame = +2 Query: 2 GDLSAIKEIIAEVDSDNDGRINYEEFCTMMRTGN--QHQPKL 121 GD + IKE++++VDSDNDGRINYEEFC MMR+GN Q QP+L Sbjct: 498 GDDATIKEVLSDVDSDNDGRINYEEFCAMMRSGNPQQQQPRL 539 >ref|NP_001059775.1| Os07g0515100 [Oryza sativa Japonica Group] gi|82654924|sp|P53683.2|CDPK2_ORYSJ RecName: Full=Calcium-dependent protein kinase isoform 2; Short=CDPK 2 gi|23616997|dbj|BAC20693.1| CDP2_ORYSA Calcium-dependent protein kinase [Oryza sativa Japonica Group] gi|113611311|dbj|BAF21689.1| Os07g0515100 [Oryza sativa Japonica Group] Length = 533 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = +2 Query: 2 GDLSAIKEIIAEVDSDNDGRINYEEFCTMMRTGNQHQPKLL 124 GD S IK+II+EVD+DNDGRINYEEFC MMR G QP L Sbjct: 492 GDTSTIKDIISEVDTDNDGRINYEEFCAMMRGGGMQQPMRL 532