BLASTX nr result
ID: Mentha24_contig00047544
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00047544 (439 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006370792.1| hypothetical protein POPTR_0001s47510g [Popu... 55 8e-06 ref|XP_002300587.1| calcium-binding EF hand family protein [Popu... 55 8e-06 >ref|XP_006370792.1| hypothetical protein POPTR_0001s47510g [Populus trichocarpa] gi|550350091|gb|ERP67361.1| hypothetical protein POPTR_0001s47510g [Populus trichocarpa] Length = 224 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/53 (52%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = +1 Query: 1 AFNSIILKFPKIDESFRKCRSTFEEFGKSASVLLDSS--LRCYEHLHKLLALF 153 +FNSIILKFPKIDESFRKC++TFE+F + ++ +D +C+ HKL F Sbjct: 41 SFNSIILKFPKIDESFRKCKATFEQFDEDSNGSIDKEELRKCF---HKLETAF 90 >ref|XP_002300587.1| calcium-binding EF hand family protein [Populus trichocarpa] gi|222847845|gb|EEE85392.1| calcium-binding EF hand family protein [Populus trichocarpa] Length = 248 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/53 (52%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = +1 Query: 1 AFNSIILKFPKIDESFRKCRSTFEEFGKSASVLLDSS--LRCYEHLHKLLALF 153 +FNSIILKFPKIDESFRKC++TFE+F + ++ +D +C+ HKL F Sbjct: 41 SFNSIILKFPKIDESFRKCKATFEQFDEDSNGSIDKEELRKCF---HKLETAF 90