BLASTX nr result
ID: Mentha24_contig00047051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00047051 (437 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002465693.1| hypothetical protein SORBIDRAFT_01g043870 [S... 56 6e-06 >ref|XP_002465693.1| hypothetical protein SORBIDRAFT_01g043870 [Sorghum bicolor] gi|241919547|gb|EER92691.1| hypothetical protein SORBIDRAFT_01g043870 [Sorghum bicolor] Length = 214 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 6/65 (9%) Frame = -1 Query: 401 ESQSPLTMNASTSDYSSGCESGWTTYLDQYSNSETYYTRGFYQEK----YIHD--DDEDL 240 E + + M A++S+ SSGC+SGWTTYLD +S+S + T F+ K Y D ++EDL Sbjct: 3 EEELAMAMAAASSECSSGCQSGWTTYLDDHSSSYSCGTERFHHGKARQPYYCDYSEEEDL 62 Query: 239 SMVSD 225 SM+SD Sbjct: 63 SMISD 67