BLASTX nr result
ID: Mentha24_contig00046658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00046658 (385 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34517.1| hypothetical protein MIMGU_mgv1a005767mg [Mimulus... 141 1e-31 gb|EPS72483.1| hypothetical protein M569_02271, partial [Genlise... 131 9e-29 ref|XP_007051476.1| Pentatricopeptide repeat (PPR-like) superfam... 131 1e-28 ref|XP_006491330.1| PREDICTED: pentatricopeptide repeat-containi... 127 2e-27 ref|XP_006444781.1| hypothetical protein CICLE_v10024306mg [Citr... 127 2e-27 ref|XP_002523294.1| pentatricopeptide repeat-containing protein,... 126 3e-27 ref|XP_002317747.2| hypothetical protein POPTR_0012s01390g, part... 125 8e-27 ref|XP_004145716.1| PREDICTED: pentatricopeptide repeat-containi... 124 1e-26 ref|NP_197146.1| pentatricopeptide repeat-containing protein [Ar... 124 1e-26 ref|XP_006400179.1| hypothetical protein EUTSA_v10013226mg [Eutr... 124 2e-26 gb|EXC20587.1| hypothetical protein L484_027142 [Morus notabilis] 123 2e-26 ref|XP_006287468.1| hypothetical protein CARUB_v10000680mg [Caps... 123 3e-26 ref|XP_002871717.1| pentatricopeptide repeat-containing protein ... 121 1e-25 ref|XP_004230006.1| PREDICTED: pentatricopeptide repeat-containi... 118 1e-24 ref|XP_006339749.1| PREDICTED: pentatricopeptide repeat-containi... 117 2e-24 ref|XP_002278172.1| PREDICTED: pentatricopeptide repeat-containi... 115 5e-24 emb|CAN70963.1| hypothetical protein VITISV_038268 [Vitis vinifera] 115 5e-24 ref|XP_007220019.1| hypothetical protein PRUPE_ppa003879mg [Prun... 115 6e-24 ref|XP_004308728.1| PREDICTED: pentatricopeptide repeat-containi... 102 6e-20 ref|XP_006832985.1| hypothetical protein AMTR_s00221p00020810 [A... 100 4e-19 >gb|EYU34517.1| hypothetical protein MIMGU_mgv1a005767mg [Mimulus guttatus] Length = 471 Score = 141 bits (355), Expect = 1e-31 Identities = 64/84 (76%), Positives = 72/84 (85%) Frame = -2 Query: 252 YTVTPPIKPWPRKLTPKRLCSIITQQQNLDLALQIFHYAGNYHPGFHHTYETYHSIIHKL 73 YTVTPPIKPWP+KLT KRLCSII QQQN+DLALQIFHYAGNYHP F + Y+TY SIIHKL Sbjct: 49 YTVTPPIKPWPQKLTTKRLCSIIAQQQNVDLALQIFHYAGNYHPNFRNNYDTYQSIIHKL 108 Query: 72 SRLRSFEPIPSLMNDLRATPIKCG 1 SR R+FEPI SL+ +LR + KCG Sbjct: 109 SRRRAFEPINSLLKELRQSQTKCG 132 >gb|EPS72483.1| hypothetical protein M569_02271, partial [Genlisea aurea] Length = 444 Score = 131 bits (330), Expect = 9e-29 Identities = 57/83 (68%), Positives = 72/83 (86%) Frame = -2 Query: 249 TVTPPIKPWPRKLTPKRLCSIITQQQNLDLALQIFHYAGNYHPGFHHTYETYHSIIHKLS 70 TVTPPIKPWP+KL+P+RLCSII QQQNLDLALQIFH+AGN+HP F H Y+TY++I++KL+ Sbjct: 1 TVTPPIKPWPQKLSPRRLCSIIAQQQNLDLALQIFHHAGNHHPNFRHNYDTYNAIVNKLA 60 Query: 69 RLRSFEPIPSLMNDLRATPIKCG 1 R R+FEPI L+ DL+ + I CG Sbjct: 61 RARAFEPIAGLLIDLKKSGIDCG 83 >ref|XP_007051476.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma cacao] gi|508703737|gb|EOX95633.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma cacao] Length = 545 Score = 131 bits (329), Expect = 1e-28 Identities = 59/84 (70%), Positives = 71/84 (84%) Frame = -2 Query: 252 YTVTPPIKPWPRKLTPKRLCSIITQQQNLDLALQIFHYAGNYHPGFHHTYETYHSIIHKL 73 YTVTPPIKPWP++L PKRL S+IT QQNLDLALQIF YAG +HP F+H Y+TYHSIIHKL Sbjct: 43 YTVTPPIKPWPQRLYPKRLVSMITCQQNLDLALQIFLYAGKFHPNFYHNYDTYHSIIHKL 102 Query: 72 SRLRSFEPIPSLMNDLRATPIKCG 1 R R+FEP+ SL++ L+ + IKCG Sbjct: 103 CRARAFEPMESLLSQLQDSQIKCG 126 >ref|XP_006491330.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like [Citrus sinensis] Length = 571 Score = 127 bits (318), Expect = 2e-27 Identities = 57/84 (67%), Positives = 70/84 (83%), Gaps = 1/84 (1%) Frame = -2 Query: 249 TVTPPIKPWPRKLTPKRLCSIITQQQNLDLALQIFHYAGNYHPGFHHTYETYHSIIHKLS 70 TVTPPIKPWP++L PKRL S+I +QQNLDLALQIFHYAG +HP F H Y+TYHSIIHKL+ Sbjct: 74 TVTPPIKPWPQRLYPKRLVSMIFRQQNLDLALQIFHYAGKFHPNFSHNYDTYHSIIHKLA 133 Query: 69 RLRSFEPIPSLMNDLRATP-IKCG 1 R R+F+ + SL+ +L+ P IKCG Sbjct: 134 RARAFDAVESLLTELKQNPEIKCG 157 >ref|XP_006444781.1| hypothetical protein CICLE_v10024306mg [Citrus clementina] gi|557547043|gb|ESR58021.1| hypothetical protein CICLE_v10024306mg [Citrus clementina] Length = 537 Score = 127 bits (318), Expect = 2e-27 Identities = 57/84 (67%), Positives = 70/84 (83%), Gaps = 1/84 (1%) Frame = -2 Query: 249 TVTPPIKPWPRKLTPKRLCSIITQQQNLDLALQIFHYAGNYHPGFHHTYETYHSIIHKLS 70 TVTPPIKPWP++L PKRL S+I +QQNLDLALQIFHYAG +HP F H Y+TYHSIIHKL+ Sbjct: 30 TVTPPIKPWPQRLYPKRLVSMIFRQQNLDLALQIFHYAGKFHPNFSHNYDTYHSIIHKLA 89 Query: 69 RLRSFEPIPSLMNDLRATP-IKCG 1 R R+F+ + SL+ +L+ P IKCG Sbjct: 90 RARAFDAVESLLTELKQNPEIKCG 113 >ref|XP_002523294.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223537382|gb|EEF39010.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 544 Score = 126 bits (317), Expect = 3e-27 Identities = 58/84 (69%), Positives = 67/84 (79%) Frame = -2 Query: 252 YTVTPPIKPWPRKLTPKRLCSIITQQQNLDLALQIFHYAGNYHPGFHHTYETYHSIIHKL 73 YTVTPPIKPWP++L PKRL S+IT+QQNLDLALQIF YAG Y P F H Y+TY SIIHKL Sbjct: 46 YTVTPPIKPWPQRLYPKRLVSMITRQQNLDLALQIFEYAGKYQPNFSHNYDTYDSIIHKL 105 Query: 72 SRLRSFEPIPSLMNDLRATPIKCG 1 SR R F P+ L++DL + IKCG Sbjct: 106 SRARVFGPVELLLSDLHKSQIKCG 129 >ref|XP_002317747.2| hypothetical protein POPTR_0012s01390g, partial [Populus trichocarpa] gi|550326138|gb|EEE95967.2| hypothetical protein POPTR_0012s01390g, partial [Populus trichocarpa] Length = 515 Score = 125 bits (313), Expect = 8e-27 Identities = 58/86 (67%), Positives = 70/86 (81%), Gaps = 2/86 (2%) Frame = -2 Query: 252 YTVTPPIKPWPRKLTPKRLCSIITQQQNLDLALQIFHYAGNYHPGFHHTYETYHSIIHKL 73 YTVTPPIKPWP++L PKRL S+IT Q+NLDLA QIF YAG YHPGF HTY+TYHSII KL Sbjct: 44 YTVTPPIKPWPQRLYPKRLISMITHQENLDLAFQIFDYAGKYHPGFSHTYDTYHSIIDKL 103 Query: 72 SRLRSFEPIPSLMNDL--RATPIKCG 1 SR R+F+ + SL++ L ++ IKCG Sbjct: 104 SRARAFDGVESLLSQLSRNSSHIKCG 129 >ref|XP_004145716.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like [Cucumis sativus] gi|449492939|ref|XP_004159147.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like [Cucumis sativus] Length = 535 Score = 124 bits (311), Expect = 1e-26 Identities = 54/83 (65%), Positives = 69/83 (83%) Frame = -2 Query: 252 YTVTPPIKPWPRKLTPKRLCSIITQQQNLDLALQIFHYAGNYHPGFHHTYETYHSIIHKL 73 YTVTPPIKPWP++L P RL ++I +QQNLDLALQIFHYAG YHP F H Y+TYH+II++L Sbjct: 37 YTVTPPIKPWPQRLFPNRLVAMIRRQQNLDLALQIFHYAGKYHPAFTHNYDTYHAIIYRL 96 Query: 72 SRLRSFEPIPSLMNDLRATPIKC 4 SR R+FEP+ SL+ +L+ + I C Sbjct: 97 SRARAFEPVESLLLELQDSGINC 119 >ref|NP_197146.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75170213|sp|Q9FFE3.1|PP388_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g16420, mitochondrial; Flags: Precursor gi|9759124|dbj|BAB09609.1| salt-inducible protein-like [Arabidopsis thaliana] gi|332004907|gb|AED92290.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 535 Score = 124 bits (311), Expect = 1e-26 Identities = 59/85 (69%), Positives = 69/85 (81%), Gaps = 2/85 (2%) Frame = -2 Query: 249 TVTPPIKPWPRKLTPKRLCSIITQQQNLDLALQIFHYAGNYHPGFHHTYETYHSIIHKLS 70 T PPIKPWP++L PKRL S+ITQQQN+DLALQIF YAG HPGF H Y+TYHSI+ KLS Sbjct: 35 TEKPPIKPWPQRLFPKRLVSMITQQQNIDLALQIFLYAGKSHPGFTHNYDTYHSILFKLS 94 Query: 69 RLRSFEPIPSLMNDLRAT--PIKCG 1 R R+F+P+ SLM DLR + PIKCG Sbjct: 95 RARAFDPVESLMADLRNSYPPIKCG 119 >ref|XP_006400179.1| hypothetical protein EUTSA_v10013226mg [Eutrema salsugineum] gi|557101269|gb|ESQ41632.1| hypothetical protein EUTSA_v10013226mg [Eutrema salsugineum] Length = 530 Score = 124 bits (310), Expect = 2e-26 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 2/86 (2%) Frame = -2 Query: 252 YTVTPPIKPWPRKLTPKRLCSIITQQQNLDLALQIFHYAGNYHPGFHHTYETYHSIIHKL 73 YT PPIKPWP++L PKRL S+ITQQQN+DLALQ+F YAG HPGF H Y+TYHSI+ KL Sbjct: 29 YTEKPPIKPWPQRLFPKRLVSMITQQQNIDLALQMFLYAGKSHPGFTHNYDTYHSILFKL 88 Query: 72 SRLRSFEPIPSLMNDLRAT--PIKCG 1 SR R+F+P+ L+ DLR++ PIKCG Sbjct: 89 SRARAFDPVEPLLADLRSSYPPIKCG 114 >gb|EXC20587.1| hypothetical protein L484_027142 [Morus notabilis] Length = 531 Score = 123 bits (309), Expect = 2e-26 Identities = 53/84 (63%), Positives = 70/84 (83%) Frame = -2 Query: 252 YTVTPPIKPWPRKLTPKRLCSIITQQQNLDLALQIFHYAGNYHPGFHHTYETYHSIIHKL 73 YTVTPPIKPWP++L PKRL SI+T+QQNLDLALQIF +AG++HPGF H Y+TYH+II +L Sbjct: 36 YTVTPPIKPWPQRLYPKRLVSILTRQQNLDLALQIFRHAGDFHPGFSHNYDTYHTIIRRL 95 Query: 72 SRLRSFEPIPSLMNDLRATPIKCG 1 S +FE + SL+++L + I+CG Sbjct: 96 SHAHAFEAVESLLSELHKSRIRCG 119 >ref|XP_006287468.1| hypothetical protein CARUB_v10000680mg [Capsella rubella] gi|482556174|gb|EOA20366.1| hypothetical protein CARUB_v10000680mg [Capsella rubella] Length = 533 Score = 123 bits (308), Expect = 3e-26 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 2/85 (2%) Frame = -2 Query: 249 TVTPPIKPWPRKLTPKRLCSIITQQQNLDLALQIFHYAGNYHPGFHHTYETYHSIIHKLS 70 T PPIKPWP++L PKRL S+ITQQQN+DLALQIF YAG HPGF H Y+TYHSI+ KLS Sbjct: 33 TEKPPIKPWPQRLFPKRLVSMITQQQNIDLALQIFLYAGKSHPGFTHNYDTYHSILFKLS 92 Query: 69 RLRSFEPIPSLMNDLRAT--PIKCG 1 R R+F+P+ SLM DLR + PI+CG Sbjct: 93 RARAFDPVESLMADLRNSYPPIRCG 117 >ref|XP_002871717.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297317554|gb|EFH47976.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 533 Score = 121 bits (303), Expect = 1e-25 Identities = 58/85 (68%), Positives = 68/85 (80%), Gaps = 2/85 (2%) Frame = -2 Query: 249 TVTPPIKPWPRKLTPKRLCSIITQQQNLDLALQIFHYAGNYHPGFHHTYETYHSIIHKLS 70 T P IKPWP++L PKRL S+ITQQQN+DLALQIF YAG HPGF H Y+TYHSI+ KLS Sbjct: 33 TEKPTIKPWPQRLFPKRLVSMITQQQNIDLALQIFLYAGKSHPGFTHNYDTYHSILFKLS 92 Query: 69 RLRSFEPIPSLMNDLRAT--PIKCG 1 R R+F+P+ SLM DLR + PIKCG Sbjct: 93 RARAFDPVESLMADLRNSYPPIKCG 117 >ref|XP_004230006.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like [Solanum lycopersicum] Length = 561 Score = 118 bits (295), Expect = 1e-24 Identities = 50/84 (59%), Positives = 68/84 (80%) Frame = -2 Query: 252 YTVTPPIKPWPRKLTPKRLCSIITQQQNLDLALQIFHYAGNYHPGFHHTYETYHSIIHKL 73 YTVTPPIKPWPR L+ K L S++ Q +++L+LQIFH+AGN+HPGF H YETYHSI++KL Sbjct: 64 YTVTPPIKPWPRYLSHKNLISLVKSQHDVNLSLQIFHHAGNFHPGFFHNYETYHSILNKL 123 Query: 72 SRLRSFEPIPSLMNDLRATPIKCG 1 R R+F+ + +L+ +LR + IKCG Sbjct: 124 CRARAFDKVETLLTELRNSGIKCG 147 >ref|XP_006339749.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like [Solanum tuberosum] Length = 564 Score = 117 bits (293), Expect = 2e-24 Identities = 51/84 (60%), Positives = 67/84 (79%) Frame = -2 Query: 252 YTVTPPIKPWPRKLTPKRLCSIITQQQNLDLALQIFHYAGNYHPGFHHTYETYHSIIHKL 73 YTVTPPIKPWPR L+ K L S++ Q +++L+LQIFH+AGN+HPGF H YETYHSII+KL Sbjct: 67 YTVTPPIKPWPRYLSHKNLISLVKSQHDVNLSLQIFHHAGNFHPGFFHNYETYHSIINKL 126 Query: 72 SRLRSFEPIPSLMNDLRATPIKCG 1 R R F+ + +L+ +LR + IKCG Sbjct: 127 CRARVFDKVETLLAELRNSTIKCG 150 >ref|XP_002278172.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Vitis vinifera] gi|296089757|emb|CBI39576.3| unnamed protein product [Vitis vinifera] Length = 586 Score = 115 bits (289), Expect = 5e-24 Identities = 51/84 (60%), Positives = 69/84 (82%) Frame = -2 Query: 252 YTVTPPIKPWPRKLTPKRLCSIITQQQNLDLALQIFHYAGNYHPGFHHTYETYHSIIHKL 73 YTVTPPIKPWP++L+PKR+ S+I++QQNLDLALQIF +AG +H F H YETY ++I KL Sbjct: 86 YTVTPPIKPWPQRLSPKRVVSMISRQQNLDLALQIFDHAGKFHRNFAHNYETYLAMIEKL 145 Query: 72 SRLRSFEPIPSLMNDLRATPIKCG 1 S+ R+FEP+ +L++ L + IKCG Sbjct: 146 SKARAFEPMETLISQLHKSQIKCG 169 >emb|CAN70963.1| hypothetical protein VITISV_038268 [Vitis vinifera] Length = 844 Score = 115 bits (289), Expect = 5e-24 Identities = 51/84 (60%), Positives = 69/84 (82%) Frame = -2 Query: 252 YTVTPPIKPWPRKLTPKRLCSIITQQQNLDLALQIFHYAGNYHPGFHHTYETYHSIIHKL 73 YTVTPPIKPWP++L+PKR+ S+I++QQNLDLALQIF +AG +H F H YETY ++I KL Sbjct: 86 YTVTPPIKPWPQRLSPKRVVSMISRQQNLDLALQIFDHAGKFHRNFAHNYETYLAMIEKL 145 Query: 72 SRLRSFEPIPSLMNDLRATPIKCG 1 S+ R+FEP+ +L++ L + IKCG Sbjct: 146 SKARAFEPMETLISQLHKSQIKCG 169 >ref|XP_007220019.1| hypothetical protein PRUPE_ppa003879mg [Prunus persica] gi|462416481|gb|EMJ21218.1| hypothetical protein PRUPE_ppa003879mg [Prunus persica] Length = 542 Score = 115 bits (288), Expect = 6e-24 Identities = 53/84 (63%), Positives = 67/84 (79%), Gaps = 1/84 (1%) Frame = -2 Query: 252 YTVTPPIKPWPRKLTPKRLCSIITQQQNLDLALQIFHYAGNYHPGFHHTYETYHSIIHKL 73 YTVTPPI+PWPR+L PKRL S+IT+Q NLDLALQIFH+A +HPGF H Y TYH+I+++L Sbjct: 43 YTVTPPIEPWPRRLHPKRLISLITRQPNLDLALQIFHHASKFHPGFSHNYHTYHAILNRL 102 Query: 72 SRLRSFE-PIPSLMNDLRATPIKC 4 SR R+F I L++DL + IKC Sbjct: 103 SRSRAFHLKIDPLLSDLSNSGIKC 126 >ref|XP_004308728.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like, partial [Fragaria vesca subsp. vesca] Length = 506 Score = 102 bits (254), Expect = 6e-20 Identities = 46/83 (55%), Positives = 60/83 (72%) Frame = -2 Query: 252 YTVTPPIKPWPRKLTPKRLCSIITQQQNLDLALQIFHYAGNYHPGFHHTYETYHSIIHKL 73 YTVTPPI WP L PKRL S+IT++ NLDLAL+IFH+A +HPGF H Y TYHS+I +L Sbjct: 8 YTVTPPIPNWPHHLHPKRLISLITREPNLDLALRIFHHASQHHPGFRHNYHTYHSLILRL 67 Query: 72 SRLRSFEPIPSLMNDLRATPIKC 4 R R+ I L++DL + ++C Sbjct: 68 LRSRALHLIDPLLSDLLRSRLRC 90 >ref|XP_006832985.1| hypothetical protein AMTR_s00221p00020810 [Amborella trichopoda] gi|548837495|gb|ERM98263.1| hypothetical protein AMTR_s00221p00020810 [Amborella trichopoda] Length = 549 Score = 99.8 bits (247), Expect = 4e-19 Identities = 44/83 (53%), Positives = 59/83 (71%) Frame = -2 Query: 252 YTVTPPIKPWPRKLTPKRLCSIITQQQNLDLALQIFHYAGNYHPGFHHTYETYHSIIHKL 73 + VTPP+ WP KL+PKRL ++I QQQN+DLALQ F YAG YHP F H +TYH+II KL Sbjct: 54 HKVTPPLTRWPLKLSPKRLINMINQQQNVDLALQFFDYAGKYHPNFSHNPDTYHTIIEKL 113 Query: 72 SRLRSFEPIPSLMNDLRATPIKC 4 +R R F + + +L+ + I+C Sbjct: 114 ARARDFNSMEITLKELKDSRIQC 136