BLASTX nr result
ID: Mentha24_contig00046579
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00046579 (581 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_358581.1| hypothetical protein PhapfoPp032 [Phalaenopsis ... 66 6e-09 gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] 65 2e-08 emb|CBI21459.3| unnamed protein product [Vitis vinifera] 50 8e-06 >ref|YP_358581.1| hypothetical protein PhapfoPp032 [Phalaenopsis aphrodite subsp. formosana] gi|58802836|gb|AAW82556.1| hypothetical protein [Phalaenopsis aphrodite subsp. formosana] Length = 103 Score = 66.2 bits (160), Expect = 6e-09 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 1 KTDQTYYYQNDMNCFKDPTCIFLHWALSLTDRNIS 105 KT++TYYY+ND+NCFKDPTCI LHWALS TD IS Sbjct: 69 KTEKTYYYRNDLNCFKDPTCILLHWALSSTDVKIS 103 >gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] Length = 53 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +1 Query: 1 KTDQTYYYQNDMNCFKDPTCIFLHWALSLTDRNIS 105 KTDQT YY+ND NCFKDPTCIFLHWALS T+ IS Sbjct: 19 KTDQTDYYRNDSNCFKDPTCIFLHWALSSTNVKIS 53 >emb|CBI21459.3| unnamed protein product [Vitis vinifera] Length = 79 Score = 50.4 bits (119), Expect(2) = 8e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = +1 Query: 1 KTDQTYYYQNDMNCFKDPTCIF 66 KTDQT YYQND+NCFKDPTCIF Sbjct: 50 KTDQTDYYQNDLNCFKDPTCIF 71 Score = 25.4 bits (54), Expect(2) = 8e-06 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +3 Query: 42 FQRPNMHFFALGSFIN 89 F+ P FFALGSFIN Sbjct: 64 FKDPTCIFFALGSFIN 79