BLASTX nr result
ID: Mentha24_contig00046484
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00046484 (387 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23848.1| hypothetical protein MIMGU_mgv1a008798mg [Mimulus... 50 6e-06 >gb|EYU23848.1| hypothetical protein MIMGU_mgv1a008798mg [Mimulus guttatus] Length = 362 Score = 50.4 bits (119), Expect(2) = 6e-06 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 5/49 (10%) Frame = -1 Query: 201 AIKSTPFKQQYFRADRDGFIKQAESKAERLSSAAFGAEMLE-----YTR 70 A K F QQY R D+DGF++QA+S+AERLS + FGAE+L YTR Sbjct: 119 ARKLRDFLQQYVRGDKDGFLRQAKSEAERLSHSDFGAEILHTIGYVYTR 167 Score = 25.0 bits (53), Expect(2) = 6e-06 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -2 Query: 77 TLGYIYTRQAVL 42 T+GY+YTRQA L Sbjct: 160 TIGYVYTRQAAL 171