BLASTX nr result
ID: Mentha24_contig00046462
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00046462 (440 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002457155.1| hypothetical protein SORBIDRAFT_03g002290 [S... 58 1e-06 >ref|XP_002457155.1| hypothetical protein SORBIDRAFT_03g002290 [Sorghum bicolor] gi|241929130|gb|EES02275.1| hypothetical protein SORBIDRAFT_03g002290 [Sorghum bicolor] Length = 437 Score = 58.2 bits (139), Expect = 1e-06 Identities = 44/149 (29%), Positives = 74/149 (49%), Gaps = 13/149 (8%) Frame = -1 Query: 437 LHDIPKFQGVGSKDNTSGSDKRQKRLDG---SSNSSRFEDDGGFYSHERPIGQKQAKNQA 267 L +PK+Q + ++NT+ KR K + +S+S++ +D + +RP GQK+AK + Sbjct: 287 LKGLPKWQRIVEEENTNS--KRTKISESGAYTSSSNQDTEDESRHKEKRPEGQKKAKAKL 344 Query: 266 RNKGKTIGSAQLEGVPE----------KMSVNLVQTMTEANTELVEWAKAKAKLTRSKAI 117 + KGK + S+ L P K+ +Q TE +E KAK TR Sbjct: 345 KGKGKKLPSSPLGDQPSQDFVLFNEAIKVKAAAMQKWTEVASES---TKAKQSQTRRDLY 401 Query: 116 RNYQKVMATYTSRMTPEQLEEHLELCNEL 30 + Y K++ TS T +QL+ H ++ +L Sbjct: 402 QTYAKLVDKDTSNFTEKQLKRHEDILEKL 430