BLASTX nr result
ID: Mentha24_contig00045943
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00045943 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAE73006.1| hypothetical protein [Macaca fascicularis] 53 4e-09 dbj|BAE89779.1| unnamed protein product [Macaca fascicularis] 53 5e-09 ref|WP_016885142.1| hypothetical protein [Bacillus licheniformis] 54 9e-08 ref|XP_002488936.1| hypothetical protein SORBIDRAFT_1514s002010 ... 54 9e-08 ref|WP_010118018.1| hypothetical protein, partial [Acinetobacter... 49 1e-07 gb|EMS64240.1| hypothetical protein TRIUR3_08371 [Triticum urartu] 52 3e-07 tpg|DAA15244.1| TPA: hypothetical protein BOS_23187 [Bos taurus] 46 6e-07 ref|XP_002449484.1| hypothetical protein SORBIDRAFT_05g016450 [S... 54 7e-07 ref|XP_002488959.1| hypothetical protein SORBIDRAFT_1180s002020 ... 49 2e-06 ref|XP_003392094.1| PREDICTED: hypothetical protein LOC100640902... 53 3e-06 gb|ETX03503.1| hypothetical protein ETSY1_47025 [Candidatus Ento... 53 4e-06 >dbj|BAE73006.1| hypothetical protein [Macaca fascicularis] Length = 218 Score = 53.1 bits (126), Expect(2) = 4e-09 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +3 Query: 216 KFLDPVQDELKRKHLPRMFSLIKNES*GIEDDQIPS 323 + L P QD +RKHLPRMFSLIKNES EDDQIPS Sbjct: 183 EILGPAQDGPERKHLPRMFSLIKNESRRFEDDQIPS 218 Score = 33.1 bits (74), Expect(2) = 4e-09 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = +2 Query: 167 MINRVCRGCSYCAARGEILG 226 MI R RG SYCAARGEILG Sbjct: 167 MIKRDGRGHSYCAARGEILG 186 >dbj|BAE89779.1| unnamed protein product [Macaca fascicularis] Length = 52 Score = 53.1 bits (126), Expect(2) = 5e-09 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +3 Query: 216 KFLDPVQDELKRKHLPRMFSLIKNES*GIEDDQIPS 323 + L P QD +RKHLPRMFSLIKNES EDDQIPS Sbjct: 17 EILGPAQDGPERKHLPRMFSLIKNESRRFEDDQIPS 52 Score = 33.1 bits (74), Expect(2) = 5e-09 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = +2 Query: 167 MINRVCRGCSYCAARGEILG 226 MI R RG SYCAARGEILG Sbjct: 1 MIKRDGRGHSYCAARGEILG 20 >ref|WP_016885142.1| hypothetical protein [Bacillus licheniformis] Length = 59 Score = 53.5 bits (127), Expect(2) = 9e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +3 Query: 231 VQDELKRKHLPRMFSLIKNES*GIEDDQIPS 323 ++DE RKHLPRMFSLIKNES G+EDDQIPS Sbjct: 29 MKDEQLRKHLPRMFSLIKNESWGLEDDQIPS 59 Score = 28.5 bits (62), Expect(2) = 9e-08 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +2 Query: 167 MINRVCRGCSYCAARGEILG 226 MINR RG SY RGEILG Sbjct: 8 MINRDSRGHSYFIVRGEILG 27 >ref|XP_002488936.1| hypothetical protein SORBIDRAFT_1514s002010 [Sorghum bicolor] gi|253759636|ref|XP_002488938.1| hypothetical protein SORBIDRAFT_1506s002010 [Sorghum bicolor] gi|253759935|ref|XP_002488954.1| hypothetical protein SORBIDRAFT_1236s002010 [Sorghum bicolor] gi|253759972|ref|XP_002488957.1| hypothetical protein SORBIDRAFT_1205s002020 [Sorghum bicolor] gi|253760151|ref|XP_002488969.1| hypothetical protein SORBIDRAFT_1050s002020 [Sorghum bicolor] gi|253760863|ref|XP_002489025.1| hypothetical protein SORBIDRAFT_0450s002020 [Sorghum bicolor] gi|253761034|ref|XP_002489038.1| hypothetical protein SORBIDRAFT_0304s002010 [Sorghum bicolor] gi|297836874|ref|XP_002886319.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|357167420|ref|XP_003581154.1| PREDICTED: uncharacterized protein LOC100830696 [Brachypodium distachyon] gi|357167890|ref|XP_003581382.1| PREDICTED: uncharacterized protein LOC100823234 [Brachypodium distachyon] gi|515510729|ref|WP_016943983.1| hypothetical protein [Gammaproteobacteria] gi|219887055|gb|ACL53902.1| unknown [Zea mays] gi|241946941|gb|EES20086.1| hypothetical protein SORBIDRAFT_1050s002020 [Sorghum bicolor] gi|241947045|gb|EES20190.1| hypothetical protein SORBIDRAFT_1205s002020 [Sorghum bicolor] gi|241947052|gb|EES20197.1| hypothetical protein SORBIDRAFT_1236s002010 [Sorghum bicolor] gi|241947162|gb|EES20307.1| hypothetical protein SORBIDRAFT_1506s002010 [Sorghum bicolor] gi|241947163|gb|EES20308.1| hypothetical protein SORBIDRAFT_1514s002010 [Sorghum bicolor] gi|241947314|gb|EES20459.1| hypothetical protein SORBIDRAFT_0304s002010 [Sorghum bicolor] gi|241947338|gb|EES20483.1| hypothetical protein SORBIDRAFT_0450s002020 [Sorghum bicolor] gi|297332159|gb|EFH62578.1| expressed protein [Arabidopsis lyrata subsp. lyrata] Length = 52 Score = 53.5 bits (127), Expect(2) = 9e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +3 Query: 231 VQDELKRKHLPRMFSLIKNES*GIEDDQIPS 323 ++DE RKHLPRMFSLIKNES G+EDDQIPS Sbjct: 22 MKDEQLRKHLPRMFSLIKNESWGLEDDQIPS 52 Score = 28.5 bits (62), Expect(2) = 9e-08 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +2 Query: 167 MINRVCRGCSYCAARGEILG 226 MINR RG SY RGEILG Sbjct: 1 MINRDSRGHSYFIVRGEILG 20 >ref|WP_010118018.1| hypothetical protein, partial [Acinetobacter sp. P8-3-8] Length = 121 Score = 48.5 bits (114), Expect(2) = 1e-07 Identities = 31/72 (43%), Positives = 37/72 (51%), Gaps = 5/72 (6%) Frame = -2 Query: 225 PRISPLAAQYEHPRQTLFIIGCGSPLR----TPCSIIPCCFIQTF-ACIKRAVLFKVNGR 61 PRISPLAAQYE PR +L I+ SIIP C IQ AC + + FKVN Sbjct: 21 PRISPLAAQYECPRPSLLIMASVPKTNKIEPRSYSIIPSCGIQAARACFEHSNFFKVNAS 80 Query: 60 PPQANQLRSARG 25 P + +S G Sbjct: 81 GPAGHSAKSIEG 92 Score = 32.7 bits (73), Expect(2) = 1e-07 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 277 NENILGKCFRFSSSCTGSK 221 NENILGKCFR SC G + Sbjct: 4 NENILGKCFRSGPSCAGPR 22 >gb|EMS64240.1| hypothetical protein TRIUR3_08371 [Triticum urartu] Length = 52 Score = 51.6 bits (122), Expect(2) = 3e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +3 Query: 231 VQDELKRKHLPRMFSLIKNES*GIEDDQIPS 323 ++DE RKHLPRMFSLIKNE G+EDDQIPS Sbjct: 22 MKDEQLRKHLPRMFSLIKNERWGLEDDQIPS 52 Score = 28.5 bits (62), Expect(2) = 3e-07 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +2 Query: 167 MINRVCRGCSYCAARGEILG 226 MINR RG SY RGEILG Sbjct: 1 MINRDSRGHSYFIVRGEILG 20 >tpg|DAA15244.1| TPA: hypothetical protein BOS_23187 [Bos taurus] Length = 185 Score = 45.8 bits (107), Expect(2) = 6e-07 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = +3 Query: 216 KFLDPVQDELKRKHLPRMFSLIKNES*GIEDDQ 314 + L P QD +RKHLPRMFSLIKNES EDD+ Sbjct: 17 EILGPAQDGPERKHLPRMFSLIKNESRRFEDDR 49 Score = 33.1 bits (74), Expect(2) = 6e-07 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = +2 Query: 167 MINRVCRGCSYCAARGEILG 226 MI R RG SYCAARGEILG Sbjct: 1 MIKRDGRGHSYCAARGEILG 20 >ref|XP_002449484.1| hypothetical protein SORBIDRAFT_05g016450 [Sorghum bicolor] gi|241935327|gb|EES08472.1| hypothetical protein SORBIDRAFT_05g016450 [Sorghum bicolor] Length = 52 Score = 53.5 bits (127), Expect(2) = 7e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +3 Query: 231 VQDELKRKHLPRMFSLIKNES*GIEDDQIPS 323 ++DE RKHLPRMFSLIKNES G+EDDQIPS Sbjct: 22 MKDEQLRKHLPRMFSLIKNESWGLEDDQIPS 52 Score = 25.4 bits (54), Expect(2) = 7e-07 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 167 MINRVCRGCSYCAARGEILG 226 MINR G SY RGEILG Sbjct: 1 MINRDSWGHSYFIVRGEILG 20 >ref|XP_002488959.1| hypothetical protein SORBIDRAFT_1180s002020 [Sorghum bicolor] gi|241947001|gb|EES20146.1| hypothetical protein SORBIDRAFT_1180s002020 [Sorghum bicolor] Length = 69 Score = 49.3 bits (116), Expect(2) = 2e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +3 Query: 231 VQDELKRKHLPRMFSLIKNES*GIEDDQI 317 ++DE RKHLPRMFSLIKNES G+EDDQI Sbjct: 22 MKDEQLRKHLPRMFSLIKNESWGLEDDQI 50 Score = 28.5 bits (62), Expect(2) = 2e-06 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +2 Query: 167 MINRVCRGCSYCAARGEILG 226 MINR RG SY RGEILG Sbjct: 1 MINRDSRGHSYFIVRGEILG 20 >ref|XP_003392094.1| PREDICTED: hypothetical protein LOC100640902 [Amphimedon queenslandica] Length = 52 Score = 52.8 bits (125), Expect(2) = 3e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 234 QDELKRKHLPRMFSLIKNES*GIEDDQIPS 323 +DE RKHLPRMFSLIKNES G EDDQIPS Sbjct: 23 EDERLRKHLPRMFSLIKNESWGFEDDQIPS 52 Score = 23.9 bits (50), Expect(2) = 3e-06 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 167 MINRVCRGCSYCAARGEILG 226 M++R G SY RGEILG Sbjct: 1 MVDRDSWGHSYSVVRGEILG 20 >gb|ETX03503.1| hypothetical protein ETSY1_47025 [Candidatus Entotheonella sp. TSY1] Length = 68 Score = 52.8 bits (125), Expect(2) = 4e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 231 VQDELKRKHLPRMFSLIKNES*GIEDDQIPS 323 ++DE RKHLPRMFSLIKNES G EDDQIPS Sbjct: 38 MKDEQVRKHLPRMFSLIKNESWGFEDDQIPS 68 Score = 23.5 bits (49), Expect(2) = 4e-06 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 167 MINRVCRGCSYCAARGEILG 226 MI R G SY RGEILG Sbjct: 17 MIERDSWGHSYLIVRGEILG 36