BLASTX nr result
ID: Mentha24_contig00045637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00045637 (471 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40348.1| hypothetical protein MIMGU_mgv1a010299mg [Mimulus... 59 7e-14 >gb|EYU40348.1| hypothetical protein MIMGU_mgv1a010299mg [Mimulus guttatus] Length = 316 Score = 58.9 bits (141), Expect(2) = 7e-14 Identities = 31/59 (52%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = -1 Query: 384 WLISSWKSREEDVPCLSRNIKEIEIVEFCDFPGWFELIKFFLQYGKSLERIKIL-HKEK 211 W S W S E DVPCLS +++ I I +F D E IKFFLQ GK LE+I+I HK+K Sbjct: 161 WWKSVWVSTEMDVPCLSHHLRRIVITDFYDSEFSMEFIKFFLQNGKMLEKIEITQHKQK 219 Score = 43.5 bits (101), Expect(2) = 7e-14 Identities = 22/45 (48%), Positives = 31/45 (68%) Frame = -3 Query: 214 KKVNLEKFYALQEVQLSSEAVSVSIISTSAFGRKELIQLVYGNCG 80 +K+N +K YALQ VQL+S+ V VS++S G+ EL+Q VY G Sbjct: 218 QKMNPQKLYALQSVQLASKEVYVSVVSHFPSGKIELLQFVYRKRG 262