BLASTX nr result
ID: Mentha24_contig00045617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00045617 (385 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43956.1| hypothetical protein MIMGU_mgv1a004424mg [Mimulus... 68 2e-09 >gb|EYU43956.1| hypothetical protein MIMGU_mgv1a004424mg [Mimulus guttatus] Length = 528 Score = 67.8 bits (164), Expect = 2e-09 Identities = 44/94 (46%), Positives = 55/94 (58%), Gaps = 3/94 (3%) Frame = +1 Query: 112 EILES-GGRRFEGRANNLDDSHEPNVRTAEKEVRSFDSSVVTGFGFSNGKVDHAEKTGLS 288 EI+E G + G ++ EPNVRT EKE+RSFDSSVVT KVD EK GL Sbjct: 169 EIVEDYNGSKSRGGRRGVEKLREPNVRTVEKELRSFDSSVVTDVS-GIAKVDDEEKNGLM 227 Query: 289 LL--LDDDSRVPSYMTLLETTRKRDRKLADLQND 384 ++ DS VP Y LL+ ++KRD +LA L D Sbjct: 228 QFDQVEVDSGVPYYKRLLDGSKKRDIRLASLSFD 261