BLASTX nr result
ID: Mentha24_contig00045146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00045146 (400 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38347.1| hypothetical protein MIMGU_mgv1a005691mg [Mimulus... 60 4e-07 >gb|EYU38347.1| hypothetical protein MIMGU_mgv1a005691mg [Mimulus guttatus] Length = 474 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 298 MSFQNNIIWLPNGSGSVANGEICYETATRIDQKR 399 MSFQNN IWL N SGS+ANGE+CY++ TRIDQKR Sbjct: 1 MSFQNNGIWLTNSSGSLANGEMCYDSTTRIDQKR 34