BLASTX nr result
ID: Mentha24_contig00045024
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00045024 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20160.1| hypothetical protein MIMGU_mgv1a011233mg [Mimulus... 72 8e-11 ref|XP_002278790.1| PREDICTED: UPF0406 protein C16orf57 homolog ... 57 2e-06 >gb|EYU20160.1| hypothetical protein MIMGU_mgv1a011233mg [Mimulus guttatus] Length = 288 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/51 (68%), Positives = 40/51 (78%), Gaps = 4/51 (7%) Frame = +1 Query: 1 DISDSLKNVIGKETKRH----VGVLSNKRLFACEFGGISCKIGNRTYEICK 141 DIS SLK V+G+E +R VG LS KRLF C+FGGISCKIGN+TYEICK Sbjct: 234 DISSSLKRVVGEEMRRQNNAIVGGLSQKRLFTCKFGGISCKIGNKTYEICK 284 >ref|XP_002278790.1| PREDICTED: UPF0406 protein C16orf57 homolog [Vitis vinifera] gi|147791224|emb|CAN70131.1| hypothetical protein VITISV_030399 [Vitis vinifera] gi|297737378|emb|CBI26579.3| unnamed protein product [Vitis vinifera] Length = 283 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/49 (55%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +1 Query: 1 DISDSLKNVIGKETKRHVGVLSN--KRLFACEFGGISCKIGNRTYEICK 141 +ISDSLK + +E +RH+ V + KR+F C+F GI CKIGN+TY+ICK Sbjct: 232 NISDSLKRAV-EEMRRHINVGGSVQKRIFTCKFNGIECKIGNKTYKICK 279