BLASTX nr result
ID: Mentha24_contig00044853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00044853 (396 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40007.1| hypothetical protein MIMGU_mgv1a001517mg [Mimulus... 58 1e-06 ref|XP_004503607.1| PREDICTED: uncharacterized protein At4g10930... 57 2e-06 ref|XP_002299464.2| hypothetical protein POPTR_0001s10770g [Popu... 56 5e-06 ref|XP_007040558.1| Uncharacterized protein TCM_016489 [Theobrom... 56 6e-06 ref|XP_002509984.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 ref|XP_004171780.1| PREDICTED: uncharacterized protein At4g10930... 55 8e-06 ref|XP_004143949.1| PREDICTED: uncharacterized protein LOC101208... 55 8e-06 >gb|EYU40007.1| hypothetical protein MIMGU_mgv1a001517mg [Mimulus guttatus] Length = 804 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 395 KEKNANFLIKEGEKVKKLAEQYVEASQQKT 306 KEKNANFLIKEGEKVKKLAEQYVEA+Q KT Sbjct: 773 KEKNANFLIKEGEKVKKLAEQYVEAAQDKT 802 >ref|XP_004503607.1| PREDICTED: uncharacterized protein At4g10930-like [Cicer arietinum] Length = 1283 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 395 KEKNANFLIKEGEKVKKLAEQYVEASQQKTKS 300 K KNANFLIKEGEKVKKLAEQYVEA+QQ KS Sbjct: 1252 KSKNANFLIKEGEKVKKLAEQYVEAAQQNRKS 1283 >ref|XP_002299464.2| hypothetical protein POPTR_0001s10770g [Populus trichocarpa] gi|550346971|gb|EEE84269.2| hypothetical protein POPTR_0001s10770g [Populus trichocarpa] Length = 1110 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 389 KNANFLIKEGEKVKKLAEQYVEASQQKTKS 300 KNANFLIKEGEKVKKLAEQYVEA+QQK +S Sbjct: 1078 KNANFLIKEGEKVKKLAEQYVEAAQQKERS 1107 >ref|XP_007040558.1| Uncharacterized protein TCM_016489 [Theobroma cacao] gi|508777803|gb|EOY25059.1| Uncharacterized protein TCM_016489 [Theobroma cacao] Length = 1326 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 389 KNANFLIKEGEKVKKLAEQYVEASQQKTK 303 KNANFLIKEGEKVKKLAEQYVEA+QQK K Sbjct: 1294 KNANFLIKEGEKVKKLAEQYVEAAQQKEK 1322 >ref|XP_002509984.1| conserved hypothetical protein [Ricinus communis] gi|223549883|gb|EEF51371.1| conserved hypothetical protein [Ricinus communis] Length = 848 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 389 KNANFLIKEGEKVKKLAEQYVEASQQKTKS 300 KNANFLIKEGEKVKKLAEQYVE +QQK KS Sbjct: 816 KNANFLIKEGEKVKKLAEQYVETAQQKEKS 845 >ref|XP_004171780.1| PREDICTED: uncharacterized protein At4g10930-like [Cucumis sativus] Length = 796 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -2 Query: 395 KEKNANFLIKEGEKVKKLAEQYVEASQQK 309 K+KNANFLIKEGEKVKKLAEQYVEA+Q+K Sbjct: 765 KDKNANFLIKEGEKVKKLAEQYVEAAQRK 793 >ref|XP_004143949.1| PREDICTED: uncharacterized protein LOC101208477 [Cucumis sativus] Length = 1237 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -2 Query: 395 KEKNANFLIKEGEKVKKLAEQYVEASQQK 309 K+KNANFLIKEGEKVKKLAEQYVEA+Q+K Sbjct: 1206 KDKNANFLIKEGEKVKKLAEQYVEAAQRK 1234