BLASTX nr result
ID: Mentha24_contig00044518
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00044518 (377 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAO00967.1| neuropeptide like precursor 3-like [Nilaparvata ... 60 4e-07 >dbj|BAO00967.1| neuropeptide like precursor 3-like [Nilaparvata lugens] Length = 169 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 375 NFAYKSVEAPAYAQVAPIITNVPTPVGVSYSAKPIIAP 262 NFAY SVEAPAYA V+P+I VPTPV VSY A P++ P Sbjct: 46 NFAYSSVEAPAYAAVSPVIKTVPTPVAVSYQATPVVLP 83