BLASTX nr result
ID: Mentha24_contig00044499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00044499 (478 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16890.3| unnamed protein product [Vitis vinifera] 118 1e-24 ref|XP_002279045.1| PREDICTED: pentatricopeptide repeat-containi... 118 1e-24 emb|CAN75614.1| hypothetical protein VITISV_022293 [Vitis vinifera] 115 5e-24 ref|XP_006340477.1| PREDICTED: pentatricopeptide repeat-containi... 114 1e-23 ref|XP_004237507.1| PREDICTED: pentatricopeptide repeat-containi... 113 2e-23 ref|XP_004140465.1| PREDICTED: pentatricopeptide repeat-containi... 112 7e-23 ref|XP_007208255.1| hypothetical protein PRUPE_ppa016546mg [Prun... 108 1e-21 ref|XP_007133767.1| hypothetical protein PHAVU_011G207300g [Phas... 103 2e-20 gb|EPS67755.1| hypothetical protein M569_07017, partial [Genlise... 102 4e-20 ref|XP_003545840.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 ref|XP_002532893.1| pentatricopeptide repeat-containing protein,... 100 3e-19 ref|XP_004288209.1| PREDICTED: pentatricopeptide repeat-containi... 100 4e-19 ref|XP_004511038.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-18 ref|XP_006594401.1| PREDICTED: pentatricopeptide repeat-containi... 96 4e-18 ref|XP_006594395.1| PREDICTED: pentatricopeptide repeat-containi... 96 4e-18 ref|XP_003627859.1| Pentatricopeptide repeat-containing protein ... 96 5e-18 ref|XP_006430873.1| hypothetical protein CICLE_v10011342mg [Citr... 94 2e-17 ref|XP_006482334.1| PREDICTED: pentatricopeptide repeat-containi... 94 3e-17 ref|XP_002870827.1| pentatricopeptide repeat-containing protein ... 92 8e-17 ref|XP_007033427.1| Tetratricopeptide repeat (TPR)-like superfam... 91 2e-16 >emb|CBI16890.3| unnamed protein product [Vitis vinifera] Length = 653 Score = 118 bits (295), Expect = 1e-24 Identities = 55/99 (55%), Positives = 69/99 (69%) Frame = -1 Query: 298 MDRLHFSSSERLLVKTVCAVVIKGYWDKLLKPKIGSSLTSSVINQVLLEFSANGFLISWP 119 M L F E L K VC +V+KG+W+ LLKP +GS+LTS+++NQVLL S +G +SW Sbjct: 26 MASLVFQCGETQLAKIVCGIVVKGHWNSLLKPNVGSNLTSTILNQVLLNLSLDGCCVSWA 85 Query: 118 FFKWVETIPQFKHSLQSSWAMICTLTKQNHFRAAQNLVE 2 FFKWVE+ KHSLQSSW MI TL K F+ AQNL+E Sbjct: 86 FFKWVESNLNHKHSLQSSWTMIHTLAKHKQFKTAQNLLE 124 >ref|XP_002279045.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Vitis vinifera] Length = 590 Score = 118 bits (295), Expect = 1e-24 Identities = 55/99 (55%), Positives = 69/99 (69%) Frame = -1 Query: 298 MDRLHFSSSERLLVKTVCAVVIKGYWDKLLKPKIGSSLTSSVINQVLLEFSANGFLISWP 119 M L F E L K VC +V+KG+W+ LLKP +GS+LTS+++NQVLL S +G +SW Sbjct: 1 MASLVFQCGETQLAKIVCGIVVKGHWNSLLKPNVGSNLTSTILNQVLLNLSLDGCCVSWA 60 Query: 118 FFKWVETIPQFKHSLQSSWAMICTLTKQNHFRAAQNLVE 2 FFKWVE+ KHSLQSSW MI TL K F+ AQNL+E Sbjct: 61 FFKWVESNLNHKHSLQSSWTMIHTLAKHKQFKTAQNLLE 99 >emb|CAN75614.1| hypothetical protein VITISV_022293 [Vitis vinifera] Length = 590 Score = 115 bits (289), Expect = 5e-24 Identities = 54/99 (54%), Positives = 68/99 (68%) Frame = -1 Query: 298 MDRLHFSSSERLLVKTVCAVVIKGYWDKLLKPKIGSSLTSSVINQVLLEFSANGFLISWP 119 M L F E L K VC +V+KG+W+ LLKP +GS+LTS+++NQVLL S +G +SW Sbjct: 1 MASLVFQCGETQLAKIVCGIVVKGHWNSLLKPNVGSNLTSTILNQVLLNLSLDGCCVSWA 60 Query: 118 FFKWVETIPQFKHSLQSSWAMICTLTKQNHFRAAQNLVE 2 FFKWVE+ HSLQSSW MI TL K F+ AQNL+E Sbjct: 61 FFKWVESNLNHXHSLQSSWTMIHTLAKHKQFKTAQNLLE 99 >ref|XP_006340477.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Solanum tuberosum] Length = 588 Score = 114 bits (285), Expect = 1e-23 Identities = 51/87 (58%), Positives = 66/87 (75%) Frame = -1 Query: 262 LVKTVCAVVIKGYWDKLLKPKIGSSLTSSVINQVLLEFSANGFLISWPFFKWVETIPQFK 83 +VK V AVV KG+WD LLKPKIGS +TS+ I+Q LL S F +SW FF+W E++P +K Sbjct: 13 MVKAVAAVVFKGHWDNLLKPKIGSFVTSTTISQALLHISQYYFSLSWSFFQWAESVPNYK 72 Query: 82 HSLQSSWAMICTLTKQNHFRAAQNLVE 2 HSLQSSW MI LTKQ HF+ AQ++++ Sbjct: 73 HSLQSSWTMIYILTKQKHFKTAQDMLQ 99 >ref|XP_004237507.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Solanum lycopersicum] Length = 588 Score = 113 bits (283), Expect = 2e-23 Identities = 51/87 (58%), Positives = 65/87 (74%) Frame = -1 Query: 262 LVKTVCAVVIKGYWDKLLKPKIGSSLTSSVINQVLLEFSANGFLISWPFFKWVETIPQFK 83 +VK V AVV KG+WD LLKPKIGSS+TS+ I Q LL S F +SW FF+W E++P K Sbjct: 13 MVKAVAAVVFKGHWDNLLKPKIGSSVTSTTIRQALLHISQYYFSLSWSFFQWAESVPSHK 72 Query: 82 HSLQSSWAMICTLTKQNHFRAAQNLVE 2 HSLQSSW M+ LTKQ HF+ AQ++++ Sbjct: 73 HSLQSSWTMMYILTKQKHFKTAQDMLQ 99 >ref|XP_004140465.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Cucumis sativus] gi|449518107|ref|XP_004166085.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Cucumis sativus] Length = 578 Score = 112 bits (279), Expect = 7e-23 Identities = 55/90 (61%), Positives = 69/90 (76%), Gaps = 2/90 (2%) Frame = -1 Query: 265 LLVKTVCAVVIKGYWDKLLKPKIGSSLTSSVINQVLLEFS--ANGFLISWPFFKWVETIP 92 LLV+++ AVV+KG+W+ LLKPKI SSLTS I+Q+LL S +G +SW FFKWVE IP Sbjct: 3 LLVQSMFAVVVKGHWNHLLKPKISSSLTSKSIHQILLRLSFYCSGPSLSWAFFKWVELIP 62 Query: 91 QFKHSLQSSWAMICTLTKQNHFRAAQNLVE 2 +KHSLQSSWAMI LT+ HF+ AQ L+E Sbjct: 63 DYKHSLQSSWAMIFILTEHKHFKTAQGLLE 92 >ref|XP_007208255.1| hypothetical protein PRUPE_ppa016546mg [Prunus persica] gi|462403897|gb|EMJ09454.1| hypothetical protein PRUPE_ppa016546mg [Prunus persica] Length = 589 Score = 108 bits (269), Expect = 1e-21 Identities = 50/94 (53%), Positives = 70/94 (74%), Gaps = 2/94 (2%) Frame = -1 Query: 277 SSERLLVKTVCAVVIKGYWDKLLKPKIGSSLTSSVINQVLLEFSANGF--LISWPFFKWV 104 + E + ++CAVV+KG+W+ +LKPKIGSSL+S+ I+QVLL+ S +G+ SW FFKWV Sbjct: 8 TGETQFIHSLCAVVVKGHWNNILKPKIGSSLSSANIHQVLLQLSLHGYGPSPSWAFFKWV 67 Query: 103 ETIPQFKHSLQSSWAMICTLTKQNHFRAAQNLVE 2 ++IP +KHSLQ W MI LT+ HF+ AQ L+E Sbjct: 68 QSIPTYKHSLQCCWTMIHILTEHKHFKPAQQLLE 101 >ref|XP_007133767.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] gi|593263178|ref|XP_007133768.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] gi|593263180|ref|XP_007133769.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] gi|561006767|gb|ESW05761.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] gi|561006768|gb|ESW05762.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] gi|561006769|gb|ESW05763.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] Length = 587 Score = 103 bits (258), Expect = 2e-20 Identities = 51/96 (53%), Positives = 66/96 (68%), Gaps = 2/96 (2%) Frame = -1 Query: 283 FSSSERLLVKTVCAVVIKGYWDKLLKPKIGSSLTSSVINQVLLEFSA--NGFLISWPFFK 110 F S R + +VC VVIKG W LLK K S+ TSS I+QVLL+ S +G S+PFFK Sbjct: 3 FIGSHRQFIDSVCTVVIKGNWGNLLKVKNASAFTSSTIHQVLLQLSLYDSGIFHSFPFFK 62 Query: 109 WVETIPQFKHSLQSSWAMICTLTKQNHFRAAQNLVE 2 W+++IP + HSLQ SWAMI LT+ HF+ AQN++E Sbjct: 63 WLDSIPHYSHSLQCSWAMIHILTEHKHFKTAQNMLE 98 >gb|EPS67755.1| hypothetical protein M569_07017, partial [Genlisea aurea] Length = 567 Score = 102 bits (255), Expect = 4e-20 Identities = 42/84 (50%), Positives = 65/84 (77%) Frame = -1 Query: 256 KTVCAVVIKGYWDKLLKPKIGSSLTSSVINQVLLEFSANGFLISWPFFKWVETIPQFKHS 77 K++CAVV+KG+WD +LKP+IG+SL+SS ++Q LL + F ISW FFKW+ET+P++K S Sbjct: 1 KSLCAVVLKGHWDTILKPRIGTSLSSSFLSQALLVLLPSQFWISWSFFKWIETVPRYKLS 60 Query: 76 LQSSWAMICTLTKQNHFRAAQNLV 5 LQS W ++C L ++ F A++++ Sbjct: 61 LQSYWVVVCVLAQRRRFETARDIL 84 >ref|XP_003545840.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Glycine max] Length = 587 Score = 100 bits (248), Expect = 3e-19 Identities = 47/93 (50%), Positives = 68/93 (73%), Gaps = 2/93 (2%) Frame = -1 Query: 274 SERLLVKTVCAVVIKGYWDKLLKPKIGSSLTSSVINQVLLEFSANGFLIS--WPFFKWVE 101 S V +VC++V+KG+W LLK K S+LTSS I++VLL+ S G+ +S +PFFKW++ Sbjct: 6 SHNQFVDSVCSIVVKGHWGNLLKVKNASALTSSTIHKVLLQLSLYGYGLSHSFPFFKWLD 65 Query: 100 TIPQFKHSLQSSWAMICTLTKQNHFRAAQNLVE 2 +IP + HSLQ SWAMI LT+ HF+ AQ+++E Sbjct: 66 SIPHYSHSLQCSWAMIHILTEHKHFKTAQHVLE 98 >ref|XP_002532893.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527353|gb|EEF29498.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 625 Score = 100 bits (248), Expect = 3e-19 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 3/94 (3%) Frame = -1 Query: 274 SERLLVKTVCAVVIKGYWDKLLKPKIGSSLTSSVINQVLLEFS--ANGFLISWPFFKWVE 101 SE LV+ +CA VIKG W+ LL+PKI S LT+S ++QVL + S + G +SW FKW+E Sbjct: 9 SETQLVQNICATVIKGGWNNLLRPKICSILTASTLHQVLYQLSLHSQGPCLSWALFKWIE 68 Query: 100 -TIPQFKHSLQSSWAMICTLTKQNHFRAAQNLVE 2 +IP +KHSLQSSW MI LTK H + AQ+L+E Sbjct: 69 SSIPNYKHSLQSSWTMIHILTKFKHLKTAQSLLE 102 >ref|XP_004288209.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Fragaria vesca subsp. vesca] Length = 589 Score = 99.8 bits (247), Expect = 4e-19 Identities = 46/92 (50%), Positives = 64/92 (69%), Gaps = 2/92 (2%) Frame = -1 Query: 271 ERLLVKTVCAVVIKGYWDKLLKPKIGSSLTSSVINQVLLEFSANGFL--ISWPFFKWVET 98 E L++++ A+V+KG+W LL PK+GS LTSS I+QVLL+ S G+ +S FFKW E+ Sbjct: 10 ETQLIQSLFAIVLKGHWSHLLNPKLGSCLTSSAIHQVLLQLSLYGYTPSLSLSFFKWAES 69 Query: 97 IPQFKHSLQSSWAMICTLTKQNHFRAAQNLVE 2 +P +KHSLQ SW M+ LTK HF+ A +E Sbjct: 70 LPNYKHSLQCSWTMVHILTKHRHFKTAHQFLE 101 >ref|XP_004511038.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Cicer arietinum] Length = 588 Score = 97.8 bits (242), Expect = 1e-18 Identities = 45/96 (46%), Positives = 67/96 (69%), Gaps = 2/96 (2%) Frame = -1 Query: 283 FSSSERLLVKTVCAVVIKGYWDKLLKPKIGSSLTSSVINQVLLEFSANGF--LISWPFFK 110 F + + L+ +VCA+V+KG W+ LLK KI S+LTS+ I+QV+L +G+ + FFK Sbjct: 4 FENHNKHLIDSVCAIVVKGNWNNLLKLKIASTLTSTTIHQVILHLRQHGYGPFFIFQFFK 63 Query: 109 WVETIPQFKHSLQSSWAMICTLTKQNHFRAAQNLVE 2 WV +IP + HSLQ SW+MI LTK +HF+ AQ +++ Sbjct: 64 WVHSIPHYTHSLQCSWSMIHMLTKHSHFKTAQQVLD 99 >ref|XP_006594401.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X7 [Glycine max] Length = 542 Score = 96.3 bits (238), Expect = 4e-18 Identities = 46/88 (52%), Positives = 65/88 (73%), Gaps = 2/88 (2%) Frame = -1 Query: 259 VKTVCAVVIKGYWDKLLKPKIGSSLTSSVINQVLLEFSANGFLISW--PFFKWVETIPQF 86 V ++CA V+KG+W L K K S+LTSS I+QVLL+ S G+ +S+ PFFKW+++IP + Sbjct: 11 VDSLCAFVVKGHWGDLSKVKNVSALTSSTIHQVLLQLSLYGYGLSYSFPFFKWLDSIPHY 70 Query: 85 KHSLQSSWAMICTLTKQNHFRAAQNLVE 2 HSLQ SWAMI LT+ HF+ AQ+++E Sbjct: 71 SHSLQCSWAMIHILTEHKHFKTAQHMLE 98 >ref|XP_006594395.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X1 [Glycine max] gi|571499072|ref|XP_006594396.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X2 [Glycine max] gi|571499074|ref|XP_006594397.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X3 [Glycine max] gi|571499076|ref|XP_006594398.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X4 [Glycine max] gi|571499078|ref|XP_006594399.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X5 [Glycine max] gi|571499080|ref|XP_006594400.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X6 [Glycine max] Length = 587 Score = 96.3 bits (238), Expect = 4e-18 Identities = 46/88 (52%), Positives = 65/88 (73%), Gaps = 2/88 (2%) Frame = -1 Query: 259 VKTVCAVVIKGYWDKLLKPKIGSSLTSSVINQVLLEFSANGFLISW--PFFKWVETIPQF 86 V ++CA V+KG+W L K K S+LTSS I+QVLL+ S G+ +S+ PFFKW+++IP + Sbjct: 11 VDSLCAFVVKGHWGDLSKVKNVSALTSSTIHQVLLQLSLYGYGLSYSFPFFKWLDSIPHY 70 Query: 85 KHSLQSSWAMICTLTKQNHFRAAQNLVE 2 HSLQ SWAMI LT+ HF+ AQ+++E Sbjct: 71 SHSLQCSWAMIHILTEHKHFKTAQHMLE 98 >ref|XP_003627859.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355521881|gb|AET02335.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 731 Score = 95.9 bits (237), Expect = 5e-18 Identities = 43/98 (43%), Positives = 67/98 (68%), Gaps = 2/98 (2%) Frame = -1 Query: 289 LHFSSSERLLVKTVCAVVIKGYWDKLLKPKIGSSLTSSVINQVLLEFSANGF--LISWPF 116 L +S + L+++VCA+++KG W+ LLKPK S+LTS+ I+QV+L + + + F Sbjct: 5 LMIETSNKHLIESVCAIIVKGDWNNLLKPKTASTLTSTTIHQVILHLKQHRYEPFFIFHF 64 Query: 115 FKWVETIPQFKHSLQSSWAMICTLTKQNHFRAAQNLVE 2 FKW ++IP + HSL SSW+MI LTK HF+ AQ +++ Sbjct: 65 FKWAQSIPHYTHSLHSSWSMIHMLTKHRHFKTAQQVLD 102 >ref|XP_006430873.1| hypothetical protein CICLE_v10011342mg [Citrus clementina] gi|557532930|gb|ESR44113.1| hypothetical protein CICLE_v10011342mg [Citrus clementina] Length = 592 Score = 94.4 bits (233), Expect = 2e-17 Identities = 47/95 (49%), Positives = 66/95 (69%), Gaps = 3/95 (3%) Frame = -1 Query: 277 SSERLLVKTVCAVVIKGYWDKLLKPKIGSSLTSSVINQVLLEFSANGFL--ISWPFFKWV 104 +S+ +KT+ A+V+KG+W KLL P I SSLTS+ I++VLL + +S FFKW Sbjct: 9 NSDTKFIKTISAIVLKGHWAKLLNPNIASSLTSTAIHKVLLNLYNCCHIPSLSCAFFKWA 68 Query: 103 ET-IPQFKHSLQSSWAMICTLTKQNHFRAAQNLVE 2 E+ +P +KHSLQS W MI LTK HF++AQN++E Sbjct: 69 ESAVPNYKHSLQSHWTMIHILTKNKHFKSAQNMLE 103 >ref|XP_006482334.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Citrus sinensis] Length = 592 Score = 93.6 bits (231), Expect = 3e-17 Identities = 47/95 (49%), Positives = 66/95 (69%), Gaps = 3/95 (3%) Frame = -1 Query: 277 SSERLLVKTVCAVVIKGYWDKLLKPKIGSSLTSSVINQVLLEFSANGFL--ISWPFFKWV 104 +S+ +KT+ A+V+KG+W KLL P I SSLTS+ I++VLL + +S FFKW Sbjct: 9 NSDTKFIKTISAIVLKGHWAKLLYPNIASSLTSTAIHKVLLNLYNCCHIPSLSCAFFKWA 68 Query: 103 ET-IPQFKHSLQSSWAMICTLTKQNHFRAAQNLVE 2 E+ +P +KHSLQS W MI LTK HF++AQN++E Sbjct: 69 ESAVPNYKHSLQSHWTMIHILTKNKHFKSAQNMLE 103 >ref|XP_002870827.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297316663|gb|EFH47086.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 582 Score = 92.0 bits (227), Expect = 8e-17 Identities = 46/104 (44%), Positives = 65/104 (62%), Gaps = 5/104 (4%) Frame = -1 Query: 298 MDRLHFSSSERLLVKTVCAVVIKGYWDKLLKPKIGSSLT-SSVINQVLLEFSA----NGF 134 M L ++ E L+ +++CA V+KG W +LK K+ S L SS+I QV+ E S G Sbjct: 1 MVNLLSANREALIAQSICATVLKGNWKNILKHKVDSGLLKSSIITQVISELSLYSGYGGP 60 Query: 133 LISWPFFKWVETIPQFKHSLQSSWAMICTLTKQNHFRAAQNLVE 2 +SW F+ W +++P KHSLQSSW MI LTK NHF+ A L++ Sbjct: 61 SLSWSFYSWTDSLPSCKHSLQSSWKMILILTKHNHFKTAHQLLD 104 >ref|XP_007033427.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508712456|gb|EOY04353.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 593 Score = 90.5 bits (223), Expect = 2e-16 Identities = 42/86 (48%), Positives = 61/86 (70%), Gaps = 3/86 (3%) Frame = -1 Query: 253 TVCAVVIKGYWDKLLKPKIGSSLTSSVINQVLLEFS--ANGFLISWPFFKWVE-TIPQFK 83 T+ +++KG+W+ LLKPKI + LTS+ IN +L + S + +SW FFKW+E +IP + Sbjct: 16 TIFTIILKGHWNTLLKPKICTQLTSTTINYLLYKLSLFCSSPSLSWSFFKWIEISIPNYD 75 Query: 82 HSLQSSWAMICTLTKQNHFRAAQNLV 5 HSLQS+WAM+ LTK HF+ A NL+ Sbjct: 76 HSLQSTWAMVHILTKHKHFKTAHNLL 101