BLASTX nr result
ID: Mentha24_contig00044421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00044421 (584 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41213.1| hypothetical protein MIMGU_mgv1a000333mg [Mimulus... 61 2e-07 >gb|EYU41213.1| hypothetical protein MIMGU_mgv1a000333mg [Mimulus guttatus] Length = 1248 Score = 61.2 bits (147), Expect = 2e-07 Identities = 38/96 (39%), Positives = 54/96 (56%), Gaps = 4/96 (4%) Frame = -1 Query: 356 LDSESFPVNSTDKTLEEEAKTDLSLDVLESKQVDSGADNIAQDMVGETDEVKSVLSSTDS 177 L+ E P+N+ ++ +EEEA T LS VL+S+Q D+ DN ++ TDE K+ +TD Sbjct: 357 LELEPHPINNKEEKVEEEATTTLSSSVLQSQQCDT-LDNNVPGILEPTDEAKTSPINTDG 415 Query: 176 HVLTTYDLVSEENNVLSVS----ETEDGAQCHEESQ 81 HV T DLV EE S ++G Q HEE + Sbjct: 416 HVETVGDLVLEEKGKEDFSVCHVNVDNGVQYHEEPE 451