BLASTX nr result
ID: Mentha24_contig00044347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00044347 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007157659.1| hypothetical protein PHAVU_002G087800g [Phas... 81 2e-13 gb|EPS71785.1| calcium-dependent protein kinase 1 [Genlisea aurea] 81 2e-13 ref|XP_004157809.1| PREDICTED: LOW QUALITY PROTEIN: calcium-depe... 81 2e-13 ref|XP_004152446.1| PREDICTED: calcium-dependent protein kinase ... 81 2e-13 ref|XP_007155355.1| hypothetical protein PHAVU_003G194100g [Phas... 80 2e-13 gb|EYU24427.1| hypothetical protein MIMGU_mgv1a004139mg [Mimulus... 79 7e-13 ref|XP_004299607.1| PREDICTED: calcium-dependent protein kinase ... 79 7e-13 ref|XP_007209864.1| hypothetical protein PRUPE_ppa003795mg [Prun... 79 7e-13 gb|AGV54376.1| calcium-dependent protein kinase 30-like protein ... 79 9e-13 ref|XP_004508790.1| PREDICTED: calcium-dependent protein kinase ... 79 9e-13 ref|XP_006367705.1| PREDICTED: calcium-dependent protein kinase ... 78 1e-12 ref|NP_001265972.1| Hop-interacting protein THI080 [Solanum lyco... 78 1e-12 gb|ABY28389.1| calcium-dependent protein kinase 1 [Datura metel] 78 1e-12 gb|AGH13200.1| calcium-dependent protein kinase [Populus euphrat... 78 1e-12 ref|XP_003528177.1| PREDICTED: calcium-dependent protein kinase ... 78 1e-12 ref|XP_003522347.1| PREDICTED: calcium-dependent protein kinase ... 78 1e-12 ref|XP_002318616.1| calcium-dependent protein kinase [Populus tr... 78 1e-12 ref|XP_002511506.1| calcium-dependent protein kinase, putative [... 77 3e-12 ref|XP_007037189.1| Calcium-dependent protein kinase 30 isoform ... 77 3e-12 gb|ADM64334.1| calcium-dependent protein kinase 9 [Nicotiana tab... 77 3e-12 >ref|XP_007157659.1| hypothetical protein PHAVU_002G087800g [Phaseolus vulgaris] gi|561031074|gb|ESW29653.1| hypothetical protein PHAVU_002G087800g [Phaseolus vulgaris] Length = 550 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = -3 Query: 330 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDGFTGQTVVV 205 GTDWRKASRQYSRERFKSLSLNLMKDGSLQL DG TGQ VVV Sbjct: 509 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLHDGITGQAVVV 550 >gb|EPS71785.1| calcium-dependent protein kinase 1 [Genlisea aurea] Length = 542 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -3 Query: 330 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDGFTGQTVVV 205 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDG TG TV+V Sbjct: 501 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDGVTGITVIV 542 >ref|XP_004157809.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 10-like [Cucumis sativus] Length = 546 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = -3 Query: 330 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDGFTGQTVVV 205 GTDWRKASRQYSRERFKSLSLNLMKDGSLQL DG TGQ VVV Sbjct: 505 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLHDGLTGQAVVV 546 >ref|XP_004152446.1| PREDICTED: calcium-dependent protein kinase 10-like [Cucumis sativus] Length = 546 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = -3 Query: 330 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDGFTGQTVVV 205 GTDWRKASRQYSRERFKSLSLNLMKDGSLQL DG TGQ VVV Sbjct: 505 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLHDGLTGQAVVV 546 >ref|XP_007155355.1| hypothetical protein PHAVU_003G194100g [Phaseolus vulgaris] gi|561028709|gb|ESW27349.1| hypothetical protein PHAVU_003G194100g [Phaseolus vulgaris] Length = 537 Score = 80.5 bits (197), Expect = 2e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -3 Query: 330 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDGFTGQTVVV 205 GTDWRKASRQYSRERFKSLS+NLMKDGSLQLQDG +GQ VVV Sbjct: 496 GTDWRKASRQYSRERFKSLSINLMKDGSLQLQDGISGQAVVV 537 >gb|EYU24427.1| hypothetical protein MIMGU_mgv1a004139mg [Mimulus guttatus] Length = 542 Score = 79.0 bits (193), Expect = 7e-13 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -3 Query: 330 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDGFTGQTVVV 205 GTDWRKASRQYSRERFKSLSLNLMKDGSL L DG TG+TVVV Sbjct: 501 GTDWRKASRQYSRERFKSLSLNLMKDGSLHLHDGVTGKTVVV 542 >ref|XP_004299607.1| PREDICTED: calcium-dependent protein kinase 10-like [Fragaria vesca subsp. vesca] Length = 547 Score = 79.0 bits (193), Expect = 7e-13 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = -3 Query: 330 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDGFTGQTVVV 205 GTDWRKASRQYSRERFKSLSLNLMKDGSLQL DG TGQ + V Sbjct: 506 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLHDGLTGQAIAV 547 >ref|XP_007209864.1| hypothetical protein PRUPE_ppa003795mg [Prunus persica] gi|462405599|gb|EMJ11063.1| hypothetical protein PRUPE_ppa003795mg [Prunus persica] Length = 548 Score = 79.0 bits (193), Expect = 7e-13 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = -3 Query: 330 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDGFTGQTVVV 205 GTDWRKASRQYSRERFKSLSLNLMKDGSLQL DG TGQ + V Sbjct: 507 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLHDGLTGQAIAV 548 >gb|AGV54376.1| calcium-dependent protein kinase 30-like protein [Phaseolus vulgaris] Length = 537 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -3 Query: 330 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDGFTGQTVVV 205 GTDWRKASRQYSRERFKSLS+NLMKDGSLQL DG +GQ VVV Sbjct: 496 GTDWRKASRQYSRERFKSLSINLMKDGSLQLHDGISGQAVVV 537 >ref|XP_004508790.1| PREDICTED: calcium-dependent protein kinase 10-like [Cicer arietinum] Length = 546 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -3 Query: 330 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDGFTGQTVVV 205 GTDWRKASRQYSRERFKSLS+NLMKDGSLQL DG +GQ VVV Sbjct: 505 GTDWRKASRQYSRERFKSLSINLMKDGSLQLHDGISGQAVVV 546 >ref|XP_006367705.1| PREDICTED: calcium-dependent protein kinase 10-like [Solanum tuberosum] Length = 538 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -3 Query: 330 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDGFTGQTVVV 205 GTDWRKASRQYSRERFKSLS+NLMKDGSLQLQD +GQTV+V Sbjct: 497 GTDWRKASRQYSRERFKSLSVNLMKDGSLQLQDVLSGQTVIV 538 >ref|NP_001265972.1| Hop-interacting protein THI080 [Solanum lycopersicum] gi|365222910|gb|AEW69807.1| Hop-interacting protein THI080 [Solanum lycopersicum] Length = 538 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -3 Query: 330 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDGFTGQTVVV 205 GTDWRKASRQYSRERFKSLS+NLMKDGSLQLQD +GQTV+V Sbjct: 497 GTDWRKASRQYSRERFKSLSVNLMKDGSLQLQDVLSGQTVIV 538 >gb|ABY28389.1| calcium-dependent protein kinase 1 [Datura metel] Length = 538 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -3 Query: 330 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDGFTGQTVVV 205 GTDWRKASRQYSRERFKSLS+NLMKDGSLQLQD +GQTV+V Sbjct: 497 GTDWRKASRQYSRERFKSLSVNLMKDGSLQLQDVLSGQTVIV 538 >gb|AGH13200.1| calcium-dependent protein kinase [Populus euphratica] Length = 555 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = -3 Query: 330 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDGFTGQTVVV 205 GTDWRKASRQYSRERFKSLSLNLMKDGSL L D FTGQ+V V Sbjct: 514 GTDWRKASRQYSRERFKSLSLNLMKDGSLHLHDAFTGQSVAV 555 >ref|XP_003528177.1| PREDICTED: calcium-dependent protein kinase 10-like [Glycine max] Length = 551 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/42 (90%), Positives = 38/42 (90%) Frame = -3 Query: 330 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDGFTGQTVVV 205 GTDWRKASRQYSRERFKSLSLNLMKDGSLQL D TGQ VVV Sbjct: 510 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLHDEITGQAVVV 551 >ref|XP_003522347.1| PREDICTED: calcium-dependent protein kinase 10-like [Glycine max] Length = 556 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/42 (90%), Positives = 38/42 (90%) Frame = -3 Query: 330 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDGFTGQTVVV 205 GTDWRKASRQYSRERFKSLSLNLMKDGSLQL D TGQ VVV Sbjct: 515 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLHDEITGQAVVV 556 >ref|XP_002318616.1| calcium-dependent protein kinase [Populus trichocarpa] gi|222859289|gb|EEE96836.1| calcium-dependent protein kinase [Populus trichocarpa] Length = 555 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = -3 Query: 330 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDGFTGQTVVV 205 GTDWRKASRQYSRERFKSLSLNLMKDGSL L D FTGQ+V V Sbjct: 514 GTDWRKASRQYSRERFKSLSLNLMKDGSLHLHDAFTGQSVAV 555 >ref|XP_002511506.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223550621|gb|EEF52108.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 549 Score = 77.0 bits (188), Expect = 3e-12 Identities = 37/42 (88%), Positives = 37/42 (88%) Frame = -3 Query: 330 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDGFTGQTVVV 205 GTDWRKASRQYSRERFKSLSLNLMKDGSLQL DG TGQ V Sbjct: 508 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLHDGLTGQCYAV 549 >ref|XP_007037189.1| Calcium-dependent protein kinase 30 isoform 1 [Theobroma cacao] gi|508774434|gb|EOY21690.1| Calcium-dependent protein kinase 30 isoform 1 [Theobroma cacao] Length = 550 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/42 (88%), Positives = 37/42 (88%) Frame = -3 Query: 330 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDGFTGQTVVV 205 GTDWRKASRQYSRERFKSLSLNLMKDGSLQL D TGQ V V Sbjct: 509 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLHDAVTGQAVAV 550 >gb|ADM64334.1| calcium-dependent protein kinase 9 [Nicotiana tabacum] Length = 538 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -3 Query: 330 GTDWRKASRQYSRERFKSLSLNLMKDGSLQLQDGFTGQTVVV 205 GTDWRKASRQYSRERFKSLS+NLMKDGSLQLQD +GQT+ V Sbjct: 497 GTDWRKASRQYSRERFKSLSVNLMKDGSLQLQDVLSGQTIAV 538