BLASTX nr result
ID: Mentha24_contig00044092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00044092 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36000.1| hypothetical protein MIMGU_mgv1a026812mg [Mimulus... 64 3e-17 gb|EXB73284.1| Double-stranded RNA-binding protein 1 [Morus nota... 47 6e-08 >gb|EYU36000.1| hypothetical protein MIMGU_mgv1a026812mg [Mimulus guttatus] Length = 301 Score = 63.5 bits (153), Expect(2) = 3e-17 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = +2 Query: 230 SYKILLNKLANDEGFFPPTYKTMRHDECESQSFSTTVEIKGEVFQGAAAKS 382 SYKILL +LA+ EGFFPP Y T + Q+FS+TVE++GEVFQG AKS Sbjct: 164 SYKILLQELADKEGFFPPKYTTTVPRDSRIQTFSSTVEVEGEVFQGDTAKS 214 Score = 50.4 bits (119), Expect(2) = 3e-17 Identities = 23/47 (48%), Positives = 31/47 (65%) Frame = +1 Query: 4 HEGFKNKLRMCAQR*NLHQPAYCTIREGHCFKARVRVGEDWFTSNEL 144 H+ FK KL++ A+ NL Y +EG C+KARV +GEDWF S +L Sbjct: 87 HDEFKKKLQIYAKNKNLDLIVYRIEKEGGCYKARVSIGEDWFESEQL 133 >gb|EXB73284.1| Double-stranded RNA-binding protein 1 [Morus notabilis] Length = 467 Score = 47.4 bits (111), Expect(2) = 6e-08 Identities = 23/57 (40%), Positives = 33/57 (57%) Frame = +2 Query: 212 HFMRRTSYKILLNKLANDEGFFPPTYKTMRHDECESQSFSTTVEIKGEVFQGAAAKS 382 +F + + YK L +LA +E F P YKT + F +TVE++GE+F G AA S Sbjct: 196 NFQKASPYKNRLQELAQEECFCMPLYKTTNYGAPHKPIFKSTVELEGEIFHGKAASS 252 Score = 35.0 bits (79), Expect(2) = 6e-08 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 3/52 (5%) Frame = +1 Query: 1 MHEGFKNKLRMCAQR*NLHQPAY---CTIREGHCFKARVRVGEDWFTSNELF 147 +H +K +L+ AQR N+ P+Y C CFKA+V VGE F S + F Sbjct: 123 IHCQYKIQLQKYAQRKNIGLPSYSIECGGAHASCFKAKVLVGEHIFESLKFF 174