BLASTX nr result
ID: Mentha24_contig00042900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00042900 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006353400.1| PREDICTED: protein LURP-one-related 14-like ... 78 1e-12 ref|XP_004240903.1| PREDICTED: protein LURP-one-related 14-like ... 78 1e-12 ref|XP_002520816.1| conserved hypothetical protein [Ricinus comm... 61 2e-07 ref|XP_006288661.1| hypothetical protein CARUB_v10001968mg [Caps... 59 7e-07 ref|XP_002316183.1| hypothetical protein POPTR_0010s18950g [Popu... 59 9e-07 >ref|XP_006353400.1| PREDICTED: protein LURP-one-related 14-like [Solanum tuberosum] Length = 201 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/51 (68%), Positives = 46/51 (90%), Gaps = 2/51 (3%) Frame = +1 Query: 1 FKVYKGETLLAEVKEKSKLGSF--GSESFEARIYPGIDYAFIVSLLVIFSE 147 FKVYKG+TL+AEVKE+ KLGSF G E+FE R+YPG+DYAFIVS+L++++E Sbjct: 146 FKVYKGDTLIAEVKERFKLGSFFKGRENFEVRVYPGVDYAFIVSILIVYNE 196 >ref|XP_004240903.1| PREDICTED: protein LURP-one-related 14-like [Solanum lycopersicum] Length = 201 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/51 (68%), Positives = 46/51 (90%), Gaps = 2/51 (3%) Frame = +1 Query: 1 FKVYKGETLLAEVKEKSKLGSF--GSESFEARIYPGIDYAFIVSLLVIFSE 147 FKVYKG+TL+AEVKE+ KLGSF G E+FE R+YPG+DYAFIVS+L++++E Sbjct: 146 FKVYKGDTLIAEVKERFKLGSFFKGRENFEVRVYPGVDYAFIVSILIVYNE 196 >ref|XP_002520816.1| conserved hypothetical protein [Ricinus communis] gi|223539947|gb|EEF41525.1| conserved hypothetical protein [Ricinus communis] Length = 198 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/53 (58%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = +1 Query: 1 FKVYKGETLLAEVKEKSKLGSF--GSESFEARIYPGIDYAFIVSLLVIFSETD 153 FKVYKG LLAEVK L SF G E + ++YP +DYAFIV+LLVI E D Sbjct: 144 FKVYKGHRLLAEVKHTFTLESFYKGKEKYSVKVYPEVDYAFIVALLVIIDEND 196 >ref|XP_006288661.1| hypothetical protein CARUB_v10001968mg [Capsella rubella] gi|482557367|gb|EOA21559.1| hypothetical protein CARUB_v10001968mg [Capsella rubella] Length = 209 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 2/52 (3%) Frame = +1 Query: 4 KVYKGETLLAEVKEKSKLGSF--GSESFEARIYPGIDYAFIVSLLVIFSETD 153 KVY TL+AEVKEKS G + G + F RI G+DYAF+VSLLVI +ET+ Sbjct: 155 KVYHANTLVAEVKEKSTFGGYFKGKQDFVVRINAGVDYAFVVSLLVILNETN 206 >ref|XP_002316183.1| hypothetical protein POPTR_0010s18950g [Populus trichocarpa] gi|222865223|gb|EEF02354.1| hypothetical protein POPTR_0010s18950g [Populus trichocarpa] Length = 195 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/53 (52%), Positives = 37/53 (69%), Gaps = 2/53 (3%) Frame = +1 Query: 1 FKVYKGETLLAEVKEKSKLGSF--GSESFEARIYPGIDYAFIVSLLVIFSETD 153 FKVY+G L+AEVK L SF G E ++ ++YP +DYAF+V+LLVI E D Sbjct: 141 FKVYEGRRLIAEVKHNFTLESFCKGKERYKVKVYPEVDYAFVVALLVILDEND 193