BLASTX nr result
ID: Mentha24_contig00042879
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00042879 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007048339.1| Cell wall / vacuolar inhibitor of fructosida... 59 5e-07 gb|EYU23785.1| hypothetical protein MIMGU_mgv1a014666mg [Mimulus... 57 3e-06 ref|XP_002309901.2| hypothetical protein POPTR_0007s03920g [Popu... 57 3e-06 gb|EYU18046.1| hypothetical protein MIMGU_mgv1a024177mg [Mimulus... 57 4e-06 gb|EXC33634.1| Pectinesterase inhibitor [Morus notabilis] 56 6e-06 ref|XP_007137711.1| hypothetical protein PHAVU_009G149400g [Phas... 55 8e-06 ref|XP_002517248.1| Pectinesterase inhibitor, putative [Ricinus ... 55 8e-06 >ref|XP_007048339.1| Cell wall / vacuolar inhibitor of fructosidase 2 [Theobroma cacao] gi|508700600|gb|EOX92496.1| Cell wall / vacuolar inhibitor of fructosidase 2 [Theobroma cacao] Length = 237 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -3 Query: 378 PGLVYPLEIARREEGLKHICDVVLGIIDTLGF 283 PGLVY EI RREEGLKHICDVVLGIID LGF Sbjct: 206 PGLVYTREIVRREEGLKHICDVVLGIIDHLGF 237 >gb|EYU23785.1| hypothetical protein MIMGU_mgv1a014666mg [Mimulus guttatus] Length = 182 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 378 PGLVYPLEIARREEGLKHICDVVLGIIDTLGF 283 PGLVYP EIA RE+GLK ICDVVLGIID LGF Sbjct: 151 PGLVYPPEIAVREDGLKRICDVVLGIIDNLGF 182 >ref|XP_002309901.2| hypothetical protein POPTR_0007s03920g [Populus trichocarpa] gi|550334083|gb|EEE90351.2| hypothetical protein POPTR_0007s03920g [Populus trichocarpa] Length = 263 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 378 PGLVYPLEIARREEGLKHICDVVLGIIDTLG 286 PGL YP E+ARRE+GLKHICDVVLG+ID LG Sbjct: 232 PGLAYPSELARREDGLKHICDVVLGMIDHLG 262 >gb|EYU18046.1| hypothetical protein MIMGU_mgv1a024177mg [Mimulus guttatus] Length = 179 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -3 Query: 378 PGLVYPLEIARREEGLKHICDVVLGIIDTLGF 283 PGL+YP IA RE+G KHICDVVLGIIDTLG+ Sbjct: 148 PGLIYPAGIALREDGFKHICDVVLGIIDTLGW 179 >gb|EXC33634.1| Pectinesterase inhibitor [Morus notabilis] Length = 192 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -3 Query: 378 PGLVYPLEIARREEGLKHICDVVLGIIDTLGF 283 PGL YP E+ARRE+GLK ICDVVLGIID LG+ Sbjct: 161 PGLPYPTELARREDGLKRICDVVLGIIDNLGW 192 >ref|XP_007137711.1| hypothetical protein PHAVU_009G149400g [Phaseolus vulgaris] gi|561010798|gb|ESW09705.1| hypothetical protein PHAVU_009G149400g [Phaseolus vulgaris] Length = 178 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 378 PGLVYPLEIARREEGLKHICDVVLGIIDTL 289 PGL YPL++ARRE+GLKHICDV +GIID L Sbjct: 147 PGLTYPLDLARREDGLKHICDVAMGIIDNL 176 >ref|XP_002517248.1| Pectinesterase inhibitor, putative [Ricinus communis] gi|223543619|gb|EEF45148.1| Pectinesterase inhibitor, putative [Ricinus communis] Length = 184 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 378 PGLVYPLEIARREEGLKHICDVVLGIIDTL 289 PGL YP EIARRE+GL+HICDVVLGI+D L Sbjct: 153 PGLAYPQEIARREQGLEHICDVVLGIVDVL 182