BLASTX nr result
ID: Mentha24_contig00042837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00042837 (392 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26589.1| hypothetical protein MIMGU_mgv1a004217mg [Mimulus... 89 5e-16 >gb|EYU26589.1| hypothetical protein MIMGU_mgv1a004217mg [Mimulus guttatus] Length = 539 Score = 89.4 bits (220), Expect = 5e-16 Identities = 45/64 (70%), Positives = 51/64 (79%) Frame = +1 Query: 1 ESFNSSPPYRLRSKRTSVLKSVEKQLDFTTVMEQDFPDNNPKDGESEIKKVPPVTKFVYT 180 +SFNSSPPYRLR KRTSVLKSVEKQLDF M DNN K G +++K++PPVTKFVYT Sbjct: 480 KSFNSSPPYRLRFKRTSVLKSVEKQLDFDISM-----DNNTKSGGADVKEIPPVTKFVYT 534 Query: 181 RQRR 192 R RR Sbjct: 535 RHRR 538