BLASTX nr result
ID: Mentha24_contig00042795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00042795 (555 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q04189.1|TAP1_ANTMA RecName: Full=Protein TAP1; Flags: Precur... 110 2e-22 gb|EYU22706.1| hypothetical protein MIMGU_mgv1a016806mg [Mimulus... 108 9e-22 gb|EYU22707.1| hypothetical protein MIMGU_mgv1a016806mg [Mimulus... 104 1e-20 gb|EYU45383.1| hypothetical protein MIMGU_mgv1a023657mg [Mimulus... 62 8e-08 ref|XP_006350917.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 gb|EXB93905.1| hypothetical protein L484_002061 [Morus notabilis] 60 5e-07 ref|XP_006480615.1| PREDICTED: pentatricopeptide repeat-containi... 60 5e-07 ref|XP_006428806.1| hypothetical protein CICLE_v10011151mg [Citr... 60 5e-07 ref|XP_007016122.1| Tetratricopeptide repeat (TPR)-like superfam... 60 5e-07 ref|XP_007206426.1| hypothetical protein PRUPE_ppa001946mg [Prun... 60 5e-07 ref|XP_004241167.1| PREDICTED: pentatricopeptide repeat-containi... 60 5e-07 ref|XP_002879234.1| predicted protein [Arabidopsis lyrata subsp.... 59 8e-07 ref|XP_006603878.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_004958944.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_006293749.1| hypothetical protein CARUB_v10022711mg [Caps... 59 1e-06 ref|XP_002314110.1| pentatricopeptide repeat-containing family p... 59 1e-06 ref|NP_180537.1| RNA editing factor OTP81 [Arabidopsis thaliana]... 59 1e-06 gb|EXC01449.1| hypothetical protein L484_022020 [Morus notabilis] 58 1e-06 ref|XP_003541672.2| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 >sp|Q04189.1|TAP1_ANTMA RecName: Full=Protein TAP1; Flags: Precursor gi|16067|emb|CAA40552.1| TAP1 [Antirrhinum majus] Length = 107 Score = 110 bits (275), Expect = 2e-22 Identities = 55/121 (45%), Positives = 66/121 (54%), Gaps = 18/121 (14%) Frame = -2 Query: 530 LIALLNVSPMMAHLPPG------------------ACIKYCPVHCLPPDTSTKEHYCSLG 405 ++A+ V + AHLPPG ACIKYCPVHCLPPD+S+KEH+C+LG Sbjct: 15 IMAIFGVHSVTAHLPPGICIDHCMKECKLSGIGVVACIKYCPVHCLPPDSSSKEHFCNLG 74 Query: 404 CMLDQCAKFTSGMQFLNLYIAQLLPISPVYDSNYDLLVADEKKMTDCVFKCRKFHCKINA 225 CMLD+CAKF DEKKM+DCVF CRKFHCKIN Sbjct: 75 CMLDKCAKFND----------------------------DEKKMSDCVFDCRKFHCKINT 106 Query: 224 E 222 + Sbjct: 107 D 107 >gb|EYU22706.1| hypothetical protein MIMGU_mgv1a016806mg [Mimulus guttatus] Length = 106 Score = 108 bits (270), Expect = 9e-22 Identities = 57/119 (47%), Positives = 63/119 (52%), Gaps = 18/119 (15%) Frame = -2 Query: 530 LIALLNVSPMMAHLPPGACI------------------KYCPVHCLPPDTSTKEHYCSLG 405 ++ +L V AHLPPG CI KYCPVHCLPPD STKEHYC+LG Sbjct: 15 VMTMLGVRLTTAHLPPGICIDHCLKECKSSGVGVAVCVKYCPVHCLPPDASTKEHYCNLG 74 Query: 404 CMLDQCAKFTSGMQFLNLYIAQLLPISPVYDSNYDLLVADEKKMTDCVFKCRKFHCKIN 228 CMLDQCAKFTS DEKKM DCV KCRK++CKIN Sbjct: 75 CMLDQCAKFTS----------------------------DEKKMNDCVSKCRKYNCKIN 105 >gb|EYU22707.1| hypothetical protein MIMGU_mgv1a016806mg [Mimulus guttatus] Length = 105 Score = 104 bits (260), Expect = 1e-20 Identities = 55/119 (46%), Positives = 62/119 (52%), Gaps = 18/119 (15%) Frame = -2 Query: 530 LIALLNVSPMMAHLPPGACI------------------KYCPVHCLPPDTSTKEHYCSLG 405 ++ +L V AHLPPG CI KYCPVHCLPPD STKEHYC+LG Sbjct: 15 VMTMLGVRLTTAHLPPGICIDHCLKECKSSGVGVAVCVKYCPVHCLPPDASTKEHYCNLG 74 Query: 404 CMLDQCAKFTSGMQFLNLYIAQLLPISPVYDSNYDLLVADEKKMTDCVFKCRKFHCKIN 228 CMLDQCAKFT +EKKM DCV KCRK++CKIN Sbjct: 75 CMLDQCAKFT-----------------------------NEKKMNDCVSKCRKYNCKIN 104 >gb|EYU45383.1| hypothetical protein MIMGU_mgv1a023657mg [Mimulus guttatus] Length = 701 Score = 62.4 bits (150), Expect = 8e-08 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 1 LYKREIVLRDRYRFHHFKGGSCSCNDYW 84 LY REIVLRDRYRFHHF+GGSCSC DYW Sbjct: 674 LYDREIVLRDRYRFHHFRGGSCSCMDYW 701 >ref|XP_006350917.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Solanum tuberosum] Length = 744 Score = 60.1 bits (144), Expect = 4e-07 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +1 Query: 1 LYKREIVLRDRYRFHHFKGGSCSCNDYW 84 LY REI+LRDRYRFHHFK G+CSC DYW Sbjct: 717 LYNREIILRDRYRFHHFKEGNCSCKDYW 744 >gb|EXB93905.1| hypothetical protein L484_002061 [Morus notabilis] Length = 705 Score = 59.7 bits (143), Expect = 5e-07 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +1 Query: 1 LYKREIVLRDRYRFHHFKGGSCSCNDYW 84 ++KREIVLRDR RFHHFK GSCSCNDYW Sbjct: 678 VFKREIVLRDRNRFHHFKEGSCSCNDYW 705 >ref|XP_006480615.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Citrus sinensis] Length = 746 Score = 59.7 bits (143), Expect = 5e-07 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +1 Query: 1 LYKREIVLRDRYRFHHFKGGSCSCNDYW 84 LY REI+LRDRYRFHHF GG+CSC DYW Sbjct: 719 LYNREILLRDRYRFHHFSGGNCSCMDYW 746 >ref|XP_006428806.1| hypothetical protein CICLE_v10011151mg [Citrus clementina] gi|557530863|gb|ESR42046.1| hypothetical protein CICLE_v10011151mg [Citrus clementina] Length = 737 Score = 59.7 bits (143), Expect = 5e-07 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +1 Query: 1 LYKREIVLRDRYRFHHFKGGSCSCNDYW 84 LY REI+LRDRYRFHHF GG+CSC DYW Sbjct: 710 LYNREILLRDRYRFHHFSGGNCSCMDYW 737 >ref|XP_007016122.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508786485|gb|EOY33741.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 733 Score = 59.7 bits (143), Expect = 5e-07 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = +1 Query: 1 LYKREIVLRDRYRFHHFKGGSCSCNDYW 84 LY REI+LRDRYRFHHF GG CSC DYW Sbjct: 706 LYNREIILRDRYRFHHFGGGHCSCKDYW 733 >ref|XP_007206426.1| hypothetical protein PRUPE_ppa001946mg [Prunus persica] gi|462402068|gb|EMJ07625.1| hypothetical protein PRUPE_ppa001946mg [Prunus persica] Length = 738 Score = 59.7 bits (143), Expect = 5e-07 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +1 Query: 1 LYKREIVLRDRYRFHHFKGGSCSCNDYW 84 LY REI+LRDRYRFHHF+ G CSCNDYW Sbjct: 711 LYDREILLRDRYRFHHFRDGHCSCNDYW 738 >ref|XP_004241167.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Solanum lycopersicum] Length = 744 Score = 59.7 bits (143), Expect = 5e-07 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +1 Query: 1 LYKREIVLRDRYRFHHFKGGSCSCNDYW 84 LY REI+LRDRYRFHHFK G+CSC DYW Sbjct: 717 LYDREIILRDRYRFHHFKEGNCSCKDYW 744 >ref|XP_002879234.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297325073|gb|EFH55493.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 740 Score = 58.9 bits (141), Expect = 8e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = +1 Query: 1 LYKREIVLRDRYRFHHFKGGSCSCNDYW 84 LY REI++RDRYRFHHF+ G CSCND+W Sbjct: 713 LYNREIIVRDRYRFHHFRNGQCSCNDFW 740 >ref|XP_006603878.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15340, mitochondrial-like [Glycine max] Length = 706 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +1 Query: 1 LYKREIVLRDRYRFHHFKGGSCSCNDYW 84 +YKREIV+RDRYRFH FK GSCSC+DYW Sbjct: 679 IYKREIVVRDRYRFHSFKQGSCSCSDYW 706 >ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Setaria italica] Length = 695 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +1 Query: 1 LYKREIVLRDRYRFHHFKGGSCSCNDYW 84 +Y REIV+RDR RFHHFK GSCSCNDYW Sbjct: 668 VYNREIVVRDRNRFHHFKDGSCSCNDYW 695 >ref|XP_004958944.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Setaria italica] Length = 594 Score = 58.5 bits (140), Expect = 1e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +1 Query: 1 LYKREIVLRDRYRFHHFKGGSCSCNDYW 84 +Y REI++RDR RFHHFKGGSCSC DYW Sbjct: 567 IYDREIIVRDRSRFHHFKGGSCSCKDYW 594 >ref|XP_006293749.1| hypothetical protein CARUB_v10022711mg [Capsella rubella] gi|482562457|gb|EOA26647.1| hypothetical protein CARUB_v10022711mg [Capsella rubella] Length = 739 Score = 58.5 bits (140), Expect = 1e-06 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = +1 Query: 1 LYKREIVLRDRYRFHHFKGGSCSCNDYW 84 LY REI++RDRYRFHHF+ G CSCND+W Sbjct: 712 LYDREIIVRDRYRFHHFRNGQCSCNDFW 739 >ref|XP_002314110.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222850518|gb|EEE88065.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 738 Score = 58.5 bits (140), Expect = 1e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +1 Query: 1 LYKREIVLRDRYRFHHFKGGSCSCNDYW 84 LY R+I+LRDRYRFHHF GG+CSC DYW Sbjct: 711 LYNRDILLRDRYRFHHFSGGNCSCMDYW 738 >ref|NP_180537.1| RNA editing factor OTP81 [Arabidopsis thaliana] gi|75100656|sp|O82380.1|PP175_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g29760, chloroplastic; Flags: Precursor gi|3582328|gb|AAC35225.1| hypothetical protein [Arabidopsis thaliana] gi|330253207|gb|AEC08301.1| RNA editing factor OTP81 [Arabidopsis thaliana] Length = 738 Score = 58.5 bits (140), Expect = 1e-06 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = +1 Query: 1 LYKREIVLRDRYRFHHFKGGSCSCNDYW 84 LY REI++RDRYRFHHF+ G CSCND+W Sbjct: 711 LYDREIIVRDRYRFHHFRNGQCSCNDFW 738 >gb|EXC01449.1| hypothetical protein L484_022020 [Morus notabilis] Length = 739 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +1 Query: 1 LYKREIVLRDRYRFHHFKGGSCSCNDYW 84 +YKREI+LRDRYRFHHFK G CSC +YW Sbjct: 712 VYKREILLRDRYRFHHFKDGHCSCGEYW 739 >ref|XP_003541672.2| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Glycine max] Length = 607 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +1 Query: 1 LYKREIVLRDRYRFHHFKGGSCSCNDYW 84 +Y REIV+RDR RFHHF+GGSCSC DYW Sbjct: 580 IYDREIVIRDRSRFHHFRGGSCSCKDYW 607