BLASTX nr result
ID: Mentha24_contig00042623
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00042623 (459 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39135.1| hypothetical protein MIMGU_mgv1a0220071mg, partia... 59 5e-07 >gb|EYU39135.1| hypothetical protein MIMGU_mgv1a0220071mg, partial [Mimulus guttatus] Length = 73 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/50 (58%), Positives = 37/50 (74%) Frame = -3 Query: 457 RKQAMELKDLEDDVKRMEMVAQTFRVRFVGMNSLCNVAESLIRRIKSMKS 308 +KQ +EL L DD+KR+EM+ + F VR VG N LC+ AESLI R+KS KS Sbjct: 19 KKQVVELSSLGDDLKRIEMLTRVFGVRLVGRNGLCDAAESLIGRMKSGKS 68