BLASTX nr result
ID: Mentha24_contig00042460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00042460 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22733.1| hypothetical protein MIMGU_mgv1a007762mg [Mimulus... 58 2e-06 >gb|EYU22733.1| hypothetical protein MIMGU_mgv1a007762mg [Mimulus guttatus] Length = 380 Score = 57.8 bits (138), Expect = 2e-06 Identities = 33/65 (50%), Positives = 39/65 (60%), Gaps = 3/65 (4%) Frame = -3 Query: 188 MSAVPSFTCRHSEIKPAFRSDNRLCLTSSINQRQLKL---RPSPEVALNRSRRAVVCTKI 18 MSAV +F+CRH ++P F S+NR L S IN R LK R EV LN SRR V I Sbjct: 1 MSAVSNFSCRHCAVRPVFWSNNRSDLASWINPRPLKFKIPRQLAEVTLNHSRRVSVSPSI 60 Query: 17 RMTTV 3 RMT + Sbjct: 61 RMTMI 65