BLASTX nr result
ID: Mentha24_contig00042270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00042270 (444 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36503.1| hypothetical protein MIMGU_mgv1a007343mg [Mimulus... 70 4e-10 >gb|EYU36503.1| hypothetical protein MIMGU_mgv1a007343mg [Mimulus guttatus] Length = 410 Score = 69.7 bits (169), Expect = 4e-10 Identities = 40/69 (57%), Positives = 49/69 (71%), Gaps = 3/69 (4%) Frame = -1 Query: 210 SNSAILCSGGLFLDSSAIPSSIVNKTVGEAFRCSYSLPV---RKGGEFLCLSLSVKGKDR 40 S +++ SGGLFLD+ +IPSS++N GE RC YS P RK G+FLCLSLSVKGKD Sbjct: 17 SKNSVFYSGGLFLDAGSIPSSVINTVCGEV-RC-YSCPAYSRRKRGDFLCLSLSVKGKDE 74 Query: 39 AIGSSVESA 13 AI +S E A Sbjct: 75 AIINSNECA 83