BLASTX nr result
ID: Mentha24_contig00041898
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00041898 (496 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45132.1| hypothetical protein MIMGU_mgv1a022534mg, partial... 67 3e-09 >gb|EYU45132.1| hypothetical protein MIMGU_mgv1a022534mg, partial [Mimulus guttatus] Length = 256 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/68 (45%), Positives = 40/68 (58%) Frame = +2 Query: 2 PWKTLTPIIWKDTRAKDTDKSWLPKSITMKKPKVSSDTPQTXXXXXXXXXXXXXXXXDST 181 PWK LTP+IWK A +D+SWLPKSI +K+ KVS + +T DST Sbjct: 188 PWKMLTPVIWKGVDALGSDQSWLPKSIAVKRAKVSPEAAKTSISQQSLAEYLAASFNDST 247 Query: 182 DEPVDKEP 205 DE VD++P Sbjct: 248 DEAVDEQP 255