BLASTX nr result
ID: Mentha24_contig00041830
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00041830 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006483487.1| PREDICTED: pentatricopeptide repeat-containi... 63 4e-08 >ref|XP_006483487.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like [Citrus sinensis] Length = 1107 Score = 63.2 bits (152), Expect = 4e-08 Identities = 35/89 (39%), Positives = 54/89 (60%), Gaps = 7/89 (7%) Frame = -3 Query: 246 SYSRASSNRRKLDSLGVLRYGSANY-WKKIKKKNGSFCGYVMKGSDEVSL------NDMS 88 +YS+ ++ S+G L+ G+ WKK KK FCGYVMK S+EV + N ++ Sbjct: 23 TYSKLHASSYNNGSVGGLKVGNLKVNWKKHWKKQVGFCGYVMKSSNEVVVVKGKPRNGLT 82 Query: 87 SEEIMARLKSISDLDLAFLFFISIVDLPH 1 SEE++ L+S SDLD + +F S+ +LP+ Sbjct: 83 SEEVIRVLRSFSDLDSTYSYFKSVAELPY 111