BLASTX nr result
ID: Mentha24_contig00041829
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00041829 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006483487.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_002283327.1| PREDICTED: pentatricopeptide repeat-containi... 56 5e-06 >ref|XP_006483487.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like [Citrus sinensis] Length = 1107 Score = 64.7 bits (156), Expect = 1e-08 Identities = 40/109 (36%), Positives = 59/109 (54%), Gaps = 15/109 (13%) Frame = -3 Query: 283 IDSSRLCVPS--------YTGASSNRRKLDSFGVLRYGSANY-WKKIKKKNGSFCGYVMK 131 IDSS C + Y+ ++ S G L+ G+ WKK KK FCGYVMK Sbjct: 6 IDSSSTCCSTISYSFAFTYSKLHASSYNNGSVGGLKVGNLKVNWKKHWKKQVGFCGYVMK 65 Query: 130 GSDEVSL------NDMSSEEIMARLKSTGDLDLAFLFFTSIVDLPHVMH 2 S+EV + N ++SEE++ L+S DLD + +F S+ +LP+V+H Sbjct: 66 SSNEVVVVKGKPRNGLTSEEVIRVLRSFSDLDSTYSYFKSVAELPYVVH 114 >ref|XP_002283327.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic [Vitis vinifera] gi|296082142|emb|CBI21147.3| unnamed protein product [Vitis vinifera] Length = 1113 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/81 (38%), Positives = 46/81 (56%), Gaps = 6/81 (7%) Frame = -3 Query: 226 KLDSFGVLRYGSANYWKKIKKKNGSFCGYVMKGSDEVSL------NDMSSEEIMARLKST 65 K+ + VL G WKK +KK CG+V++ S +V + + MSSEE+ LKS Sbjct: 40 KIGNLKVLPSGCRVNWKKHRKKQVGVCGFVIRSSFDVVVVKRKPESTMSSEEVYRVLKSI 99 Query: 64 GDLDLAFLFFTSIVDLPHVMH 2 D + AF FF S+ ++P V+H Sbjct: 100 SDPNQAFSFFNSVAEMPRVIH 120