BLASTX nr result
ID: Mentha24_contig00041714
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00041714 (512 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS63113.1| hypothetical protein M569_11675, partial [Genlise... 57 3e-06 >gb|EPS63113.1| hypothetical protein M569_11675, partial [Genlisea aurea] Length = 167 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -3 Query: 126 LKKDGRFGVLIKLLQSTKVADNIDSQLIDSANGLTVFAPTD 4 L+K G+FGVLI+LLQ+TKV D ID+QL +S GLT+FAP+D Sbjct: 13 LEKAGQFGVLIRLLQTTKVGDQIDTQLGNSNQGLTIFAPSD 53