BLASTX nr result
ID: Mentha24_contig00041667
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00041667 (352 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD56221.1| hypothetical protein [Cicer arietinum] 62 1e-07 emb|CBI39671.3| unnamed protein product [Vitis vinifera] 47 2e-06 >emb|CAD56221.1| hypothetical protein [Cicer arietinum] Length = 206 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 104 HQLWKILRIS*SFYYLVACTACFLHIIKIQVIAE 3 HQLWKILRIS SFYYLVA +ACF+HI+KIQV+AE Sbjct: 12 HQLWKILRISCSFYYLVASSACFVHIMKIQVLAE 45 >emb|CBI39671.3| unnamed protein product [Vitis vinifera] Length = 313 Score = 46.6 bits (109), Expect(2) = 2e-06 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = -3 Query: 350 FTAEENIQRKKLDIEVEETVELVKKRE 270 FTAEENIQRKKLD+E+EET E KKRE Sbjct: 115 FTAEENIQRKKLDVELEETEEHAKKRE 141 Score = 30.4 bits (67), Expect(2) = 2e-06 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -1 Query: 166 QKAEYSIYVCLLMGMV 119 +KA YSIYVCLL GMV Sbjct: 141 EKAAYSIYVCLLTGMV 156