BLASTX nr result
ID: Mentha24_contig00041395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00041395 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25782.1| hypothetical protein MIMGU_mgv1a0106081mg, partia... 55 8e-06 >gb|EYU25782.1| hypothetical protein MIMGU_mgv1a0106081mg, partial [Mimulus guttatus] Length = 142 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 311 DVPPQDKEQITQDLKSFLQPLRKVLLQFEEELKDR 207 DVP QDK +I +DLK FLQPLR+ LLQFEEELKDR Sbjct: 108 DVPQQDKVRIIKDLKLFLQPLREKLLQFEEELKDR 142