BLASTX nr result
ID: Mentha24_contig00041274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00041274 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46469.1| hypothetical protein MIMGU_mgv1a001180mg [Mimulus... 74 2e-11 >gb|EYU46469.1| hypothetical protein MIMGU_mgv1a001180mg [Mimulus guttatus] Length = 871 Score = 74.3 bits (181), Expect = 2e-11 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 5/62 (8%) Frame = -3 Query: 321 EPPNFY--HETSRDCYDNYSERSGEGR---QLDLGKSKGLSKTFYMDNLDGGNFDLPFVD 157 EPPNFY T R Y+N SERS E QLDL S+GLS+TFYMD++DGG+F+LPFVD Sbjct: 791 EPPNFYGAENTFRGGYENLSERSEEEEEEEQLDLRNSRGLSRTFYMDDVDGGDFNLPFVD 850 Query: 156 VY 151 +Y Sbjct: 851 IY 852