BLASTX nr result
ID: Mentha24_contig00041231
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00041231 (356 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31347.1| hypothetical protein MIMGU_mgv1a007290mg [Mimulus... 60 3e-07 gb|EYU36279.1| hypothetical protein MIMGU_mgv1a007802mg [Mimulus... 59 9e-07 >gb|EYU31347.1| hypothetical protein MIMGU_mgv1a007290mg [Mimulus guttatus] Length = 412 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -1 Query: 356 NIVGRSVFRYWPPSRVADTMYNTSQRGGAIAFS 258 NIVGRSVFRYWPPS+V+DT+YNTSQ+ A+AF+ Sbjct: 380 NIVGRSVFRYWPPSKVSDTLYNTSQQKSAVAFA 412 >gb|EYU36279.1| hypothetical protein MIMGU_mgv1a007802mg [Mimulus guttatus] Length = 395 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 356 NIVGRSVFRYWPPSRVADTMYNTSQRGGAIAFS 258 NI+GRSVFRYWPPS+V+DT+YNTSQ+ A AFS Sbjct: 363 NILGRSVFRYWPPSKVSDTLYNTSQQRSAAAFS 395