BLASTX nr result
ID: Mentha24_contig00041127
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00041127 (461 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27961.1| hypothetical protein MIMGU_mgv1a015869mg [Mimulus... 74 2e-11 >gb|EYU27961.1| hypothetical protein MIMGU_mgv1a015869mg [Mimulus guttatus] Length = 142 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/55 (60%), Positives = 40/55 (72%) Frame = -2 Query: 460 CGYKFEVPSEKVSQVHSRPPKPPIERKPVENPPTAESRPANAAKPDPEEVPTTSA 296 CGYKF++P EKVSQVHSRPPK P+E KP + S+ +N KP P E+PTTSA Sbjct: 88 CGYKFDIPLEKVSQVHSRPPKDPVEEKPHAPVGESSSKISNVVKPPPGEIPTTSA 142