BLASTX nr result
ID: Mentha24_contig00040956
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00040956 (432 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67084.1| hypothetical protein M569_07690 [Genlisea aurea] 60 3e-07 >gb|EPS67084.1| hypothetical protein M569_07690 [Genlisea aurea] Length = 492 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 430 EFEEASSVTKALEASPVTIGTRQAVVEEKRSTNTKGN 320 EFE+ASSV KALEASPV IG RQA VEEKRSTN++GN Sbjct: 338 EFEDASSVQKALEASPVIIGGRQAFVEEKRSTNSRGN 374