BLASTX nr result
ID: Mentha24_contig00040926
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00040926 (488 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32110.1| hypothetical protein MIMGU_mgv1a007916mg [Mimulus... 48 6e-08 >gb|EYU32110.1| hypothetical protein MIMGU_mgv1a007916mg [Mimulus guttatus] Length = 391 Score = 48.1 bits (113), Expect(2) = 6e-08 Identities = 26/49 (53%), Positives = 33/49 (67%) Frame = +2 Query: 341 NPRLGFCNSSKRVAETKTSSGNSSRMAAIRCGGSQGMQADKFDDVYYMR 487 N +LGF NS+KRV+ + SS S+ +A I CGGSQ Q + DD YYMR Sbjct: 28 NSQLGFSNSAKRVSVSGISSRKSAHLAMIVCGGSQDKQ-EVVDDGYYMR 75 Score = 34.3 bits (77), Expect(2) = 6e-08 Identities = 19/35 (54%), Positives = 21/35 (60%) Frame = +1 Query: 250 MYAQTLPIRIPNHISHNPPVNRFHNLAFSPKSKIG 354 MYAQTLP HI HNPP R AF P S++G Sbjct: 1 MYAQTLPFS--KHIIHNPPTKR-QIPAFPPNSQLG 32