BLASTX nr result
ID: Mentha24_contig00040552
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00040552 (579 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015750.1| F-box and associated interaction domains-con... 62 1e-07 >ref|XP_007015750.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590586605|ref|XP_007015751.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786113|gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 61.6 bits (148), Expect = 1e-07 Identities = 40/95 (42%), Positives = 49/95 (51%), Gaps = 7/95 (7%) Frame = -1 Query: 264 SLLTWMSEN---SKTIKLPSFDG----PTMGGCCAGLLYLDDCKGKAVTFNPLTREFKFL 106 +L T EN ++ I LP F+ P + G C GLL L D GKA +NP TREFK L Sbjct: 79 ALSTEKGENFSVTENIHLPFFENCWYAPVVSGPCNGLLCLHDA-GKAALWNPSTREFKIL 137 Query: 105 PPYHFKPSPYTNDLPCVAAGFGYDYLCRDYKVVRF 1 P P + GFG+D + DYKVVRF Sbjct: 138 PRSSVNRPPSVDSTSFGCLGFGFDSITDDYKVVRF 172