BLASTX nr result
ID: Mentha24_contig00040539
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00040539 (400 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43174.1| hypothetical protein MIMGU_mgv1a014963mg [Mimulus... 57 3e-06 >gb|EYU43174.1| hypothetical protein MIMGU_mgv1a014963mg [Mimulus guttatus] gi|604344421|gb|EYU43175.1| hypothetical protein MIMGU_mgv1a014963mg [Mimulus guttatus] Length = 172 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/38 (63%), Positives = 34/38 (89%) Frame = -3 Query: 116 MHGVRQTFNQMYRKLHTLSHDSPSDTLRRKVVELEKKR 3 M+GVR+T +Q+ RK+HTLSHD PSDTL+RK+ +LEK++ Sbjct: 1 MNGVRRTLSQICRKVHTLSHDGPSDTLKRKLADLEKEK 38