BLASTX nr result
ID: Mentha24_contig00040524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00040524 (376 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007133527.1| hypothetical protein PHAVU_011G186700g [Phas... 58 2e-06 >ref|XP_007133527.1| hypothetical protein PHAVU_011G186700g [Phaseolus vulgaris] gi|561006527|gb|ESW05521.1| hypothetical protein PHAVU_011G186700g [Phaseolus vulgaris] Length = 199 Score = 57.8 bits (138), Expect = 2e-06 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 5/58 (8%) Frame = -2 Query: 159 CNEWLVGEMDDGDDLEKD---YVFDGD-TLE*QTVLEASGIGEP-TKHTRSTTGKRKE 1 CNEWLVG++DD +D E++ + FD D TL +TV EASG+GEP T R TT KRK+ Sbjct: 125 CNEWLVGQVDDDNDNEREKINWFFDDDPTLNQETVYEASGVGEPITYIRRQTTSKRKQ 182