BLASTX nr result
ID: Mentha24_contig00040506
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00040506 (416 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006356633.1| PREDICTED: uncharacterized protein LOC102587... 60 3e-07 ref|XP_004245250.1| PREDICTED: uncharacterized protein LOC101255... 60 4e-07 gb|EXC32780.1| hypothetical protein L484_019894 [Morus notabilis] 57 3e-06 >ref|XP_006356633.1| PREDICTED: uncharacterized protein LOC102587086 [Solanum tuberosum] Length = 288 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/45 (55%), Positives = 37/45 (82%) Frame = -2 Query: 409 LAEKLGRALELGLLVQKILAAVFMDFSIYAVVLISGLSLVQKLAW 275 + +++G+ALELGLL+Q I+ AVFMD SIY++ ++ GLS+ QKL W Sbjct: 244 MVDQIGKALELGLLLQSIMGAVFMDCSIYSITVVCGLSIAQKLGW 288 >ref|XP_004245250.1| PREDICTED: uncharacterized protein LOC101255319 [Solanum lycopersicum] Length = 284 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/45 (53%), Positives = 37/45 (82%) Frame = -2 Query: 409 LAEKLGRALELGLLVQKILAAVFMDFSIYAVVLISGLSLVQKLAW 275 + +++G+ALELGLL+Q ++ AVFMD SIY++ ++ GLS+ QKL W Sbjct: 240 MVDQIGKALELGLLLQNVMGAVFMDCSIYSITVVCGLSIAQKLGW 284 >gb|EXC32780.1| hypothetical protein L484_019894 [Morus notabilis] Length = 287 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/44 (54%), Positives = 35/44 (79%) Frame = -2 Query: 415 NDLAEKLGRALELGLLVQKILAAVFMDFSIYAVVLISGLSLVQK 284 ND E+LG+ LE+GLL+Q++ AVFMD ++YAV+++ GLS QK Sbjct: 242 NDWTEQLGKTLEIGLLIQRVADAVFMDCAVYAVIVVCGLSFTQK 285