BLASTX nr result
ID: Mentha24_contig00040463
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00040463 (489 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30823.1| hypothetical protein MIMGU_mgv1a010680mg [Mimulus... 60 2e-07 gb|EYU30361.1| hypothetical protein MIMGU_mgv1a007793mg [Mimulus... 57 3e-06 >gb|EYU30823.1| hypothetical protein MIMGU_mgv1a010680mg [Mimulus guttatus] Length = 305 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -3 Query: 487 AQACSDVNLKYLPSWEINGELLGGSKSLEQLATLSGIKLEDLSQ*N 350 A+AC++ NL PSWEING+ G+K +LA LSGIKLEDLSQ N Sbjct: 260 AKACTEANLDGFPSWEINGQFFSGTKQFPELARLSGIKLEDLSQQN 305 >gb|EYU30361.1| hypothetical protein MIMGU_mgv1a007793mg [Mimulus guttatus] Length = 395 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = -3 Query: 487 AQACSDVNLKYLPSWEINGELLGGSKSLEQLATLSGIKLEDLSQ*N 350 AQ CSD L+ P+WEING++L G K L +LATLSG KL++ S N Sbjct: 350 AQICSDAKLEGFPTWEINGQVLSGEKQLSELATLSGFKLDESSPSN 395