BLASTX nr result
ID: Mentha24_contig00040287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00040287 (419 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS66792.1| hypothetical protein M569_07985, partial [Genlise... 59 9e-07 >gb|EPS66792.1| hypothetical protein M569_07985, partial [Genlisea aurea] Length = 768 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = -2 Query: 148 EKTPLKQAEKGDKSSSFFSPLGAGQLMTFESGVKPRGPVSIPTSSLPDL 2 E TP++Q EK D + F SPLG+GQLM F S +KP G SIP S LPDL Sbjct: 77 EATPVRQNEKRDNALPFSSPLGSGQLMNFYSTMKPGGHFSIPASGLPDL 125