BLASTX nr result
ID: Mentha24_contig00040184
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00040184 (358 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25153.1| hypothetical protein MIMGU_mgv1a026448mg [Mimulus... 57 3e-06 >gb|EYU25153.1| hypothetical protein MIMGU_mgv1a026448mg [Mimulus guttatus] Length = 470 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/60 (46%), Positives = 34/60 (56%) Frame = +3 Query: 66 FVKNSTYIIYLPNILVKNGSNFSVFPSTASPYSSSHQTPVSYHQTAMTRSPLSPYNHSPI 245 F + Y+ I + + + SPYSS HQTP+S HQTA TRSPLSPY SPI Sbjct: 370 FDETDEYVDIHNRIKINLSPTLKLSSKSLSPYSSIHQTPISCHQTATTRSPLSPYTQSPI 429