BLASTX nr result
ID: Mentha24_contig00039479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00039479 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31145.1| hypothetical protein MIMGU_mgv1a020597mg, partial... 81 1e-13 ref|XP_002533810.1| nuclear receptor binding set domain containi... 65 8e-09 gb|EYU24079.1| hypothetical protein MIMGU_mgv1a000797mg [Mimulus... 61 1e-07 ref|XP_002267100.2| PREDICTED: zinc finger CCCH domain-containin... 57 2e-06 >gb|EYU31145.1| hypothetical protein MIMGU_mgv1a020597mg, partial [Mimulus guttatus] Length = 1336 Score = 81.3 bits (199), Expect = 1e-13 Identities = 52/103 (50%), Positives = 63/103 (61%), Gaps = 5/103 (4%) Frame = +1 Query: 88 SSERAEVVHILDL-PSPTPM----NQSLQKSAVLELLSPAPRLNDENEAALATTETKASG 252 SS + + V +LDL PSPTP N LQ +LELLS APR NDE+E TK SG Sbjct: 966 SSRQRKDVDVLDLLPSPTPKTAAENPVLQNCGILELLSLAPRSNDEDE-------TKQSG 1018 Query: 253 PVSNSGMGWNCNVQLPEVADEWCGYSPTPVKPSIQEWDPGLLS 381 + + G + N+ VADEWCGYSPTP K +QEWD GL+S Sbjct: 1019 CIKSPTNGGS-NIG---VADEWCGYSPTPGKTDLQEWDSGLVS 1057 >ref|XP_002533810.1| nuclear receptor binding set domain containing protein 1, nsd, putative [Ricinus communis] gi|223526264|gb|EEF28579.1| nuclear receptor binding set domain containing protein 1, nsd, putative [Ricinus communis] Length = 1586 Score = 65.5 bits (158), Expect = 8e-09 Identities = 41/111 (36%), Positives = 60/111 (54%), Gaps = 6/111 (5%) Frame = +1 Query: 67 AILEQPQSSERAEVVHILDLPSPTPMNQSLQKSAVLELLSPAPRLNDENEAALATTETKA 246 ++ + + SE+ + + + DLPSPTP K + EL A EN+ +++ + Sbjct: 1079 SMAKSSEKSEQNQEIVVSDLPSPTP------KQSHEELKGQA-----ENKLSVS-----S 1122 Query: 247 SGPVSNSGMGWN------CNVQLPEVADEWCGYSPTPVKPSIQEWDPGLLS 381 S PV +SG W+ QLPEVA EW GYSP KPS++EWD L+S Sbjct: 1123 SAPVQDSGPSWSTASSLVVGRQLPEVAGEWGGYSPASAKPSVEEWDSNLVS 1173 >gb|EYU24079.1| hypothetical protein MIMGU_mgv1a000797mg [Mimulus guttatus] Length = 983 Score = 61.2 bits (147), Expect = 1e-07 Identities = 35/85 (41%), Positives = 46/85 (54%), Gaps = 1/85 (1%) Frame = +1 Query: 130 SPTPMNQSLQKSAVLELLSPAPRLNDENEAALATTETKASGPVSNSGMGWNCNVQLPEVA 309 +P N LQ S +LELLSP D+++A + PV N+G W PEVA Sbjct: 638 APVSTNFPLQNSGILELLSP----KDDHKATEKPPPGLPNFPVPNAGPSWT-----PEVA 688 Query: 310 DEWCGYSPTPVKP-SIQEWDPGLLS 381 +EWCGY+ TP KP + WD L+S Sbjct: 689 NEWCGYASTPAKPCAADAWDSDLVS 713 >ref|XP_002267100.2| PREDICTED: zinc finger CCCH domain-containing protein 44-like [Vitis vinifera] Length = 1643 Score = 57.4 bits (137), Expect = 2e-06 Identities = 35/101 (34%), Positives = 56/101 (55%), Gaps = 14/101 (13%) Frame = +1 Query: 121 DLPSPTPMNQSLQKSAVLE---LLSPAPRLND---ENEAALATTETKASGPVSNSGMGWN 282 D+ S ++++L++ + L SP P+ +D + +AA + + PV +SG W+ Sbjct: 1191 DVVSVAKLSKTLEQDHDINFPNLPSPTPKPSDGDWKGQAAESKQSVSSDVPVQDSGPSWS 1250 Query: 283 C-------NVQLPEVADEWCGYS-PTPVKPSIQEWDPGLLS 381 +LPEVA +W GYS PTP+KPS++EWD L S Sbjct: 1251 TASSLVGGGTKLPEVASDWGGYSSPTPMKPSVEEWDSTLAS 1291